Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 604716..605530 | Replicon | chromosome |
Accession | NZ_LR130532 | ||
Organism | Escherichia coli isolate ecoli019 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | EJK95_RS02955 | Protein ID | WP_001054376.1 |
Coordinates | 605273..605530 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | EJK95_RS02950 | Protein ID | WP_001309181.1 |
Coordinates | 604716..605261 (-) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EJK95_RS02925 | 600407..601720 | - | 1314 | WP_000460843.1 | galactitol-specific PTS transporter subunit IIC | - |
EJK95_RS02930 | 601732..602010 | - | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB | - |
EJK95_RS02935 | 602007..603128 | - | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
EJK95_RS24745 | 603373..603489 | - | 117 | Protein_539 | VOC family protein | - |
EJK95_RS02940 | 603527..603745 | - | 219 | Protein_540 | hypothetical protein | - |
EJK95_RS02945 | 603914..604660 | - | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
EJK95_RS02950 | 604716..605261 | - | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
EJK95_RS02955 | 605273..605530 | - | 258 | WP_001054376.1 | hypothetical protein | Toxin |
EJK95_RS02960 | 605907..606152 | - | 246 | Protein_544 | GNAT family N-acetyltransferase | - |
EJK95_RS02965 | 606268..607508 | + | 1241 | Protein_545 | helicase YjhR | - |
EJK95_RS02970 | 608091..609071 | - | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
EJK95_RS02975 | 609136..610242 | - | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimB / fimE / fimA / fimI / fimC | 568062..616495 | 48433 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T286216 WP_001054376.1 NZ_LR130532:c605530-605273 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT286216 WP_001309181.1 NZ_LR130532:c605261-604716 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|