Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 5678841..5679511 | Replicon | chromosome |
Accession | NZ_LR130528 | ||
Organism | Pseudomonas aeruginosa isolate paerg000 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | EJN10_RS26980 | Protein ID | WP_023114647.1 |
Coordinates | 5678841..5679260 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | EJN10_RS26985 | Protein ID | WP_023114648.1 |
Coordinates | 5679257..5679511 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EJN10_RS26950 | 5674794..5675252 | + | 459 | WP_023114640.1 | helix-turn-helix domain-containing protein | - |
EJN10_RS26955 | 5675291..5675659 | - | 369 | WP_023114641.1 | conjugal transfer transcriptional regulator TraJ | - |
EJN10_RS26960 | 5675662..5675946 | - | 285 | WP_023114642.1 | hypothetical protein | - |
EJN10_RS26965 | 5675958..5676200 | - | 243 | WP_124034060.1 | type I toxin-antitoxin system ptaRNA1 family toxin | - |
EJN10_RS26970 | 5676269..5677740 | - | 1472 | Protein_5196 | P-type conjugative transfer protein TrbL | - |
EJN10_RS31110 | 5677742..5677900 | - | 159 | WP_172605026.1 | hypothetical protein | - |
EJN10_RS26975 | 5677915..5678685 | - | 771 | WP_023114646.1 | P-type conjugative transfer protein TrbJ | - |
EJN10_RS26980 | 5678841..5679260 | - | 420 | WP_023114647.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
EJN10_RS26985 | 5679257..5679511 | - | 255 | WP_023114648.1 | Arc family DNA-binding protein | Antitoxin |
EJN10_RS26990 | 5680806..5681783 | - | 978 | WP_031637437.1 | plasmid replication | - |
EJN10_RS26995 | 5681764..5682657 | - | 894 | WP_031637438.1 | helicase RepA family protein | - |
EJN10_RS27000 | 5682660..5682884 | - | 225 | WP_023114650.1 | AlpA family phage regulatory protein | - |
EJN10_RS27005 | 5682978..5683970 | + | 993 | WP_023114651.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 5675662..5685574 | 9912 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14925.16 Da Isoelectric Point: 5.1890
>T286202 WP_023114647.1 NZ_LR130528:c5679260-5678841 [Pseudomonas aeruginosa]
MIVLDTNVVSEAMKPEPNPAVRAWLNEQVVETLYLSSVTLAELLFGIGALPNGKRKKGLGEALDGLLELFGERVLMFDTE
AARHYAELAVKARTAGKGFPTPDGYIGAIAASKGFIVATRDTSPFEAAGLTVINPWNHQ
MIVLDTNVVSEAMKPEPNPAVRAWLNEQVVETLYLSSVTLAELLFGIGALPNGKRKKGLGEALDGLLELFGERVLMFDTE
AARHYAELAVKARTAGKGFPTPDGYIGAIAASKGFIVATRDTSPFEAAGLTVINPWNHQ
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|