Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 4567208..4568250 | Replicon | chromosome |
Accession | NZ_LR130528 | ||
Organism | Pseudomonas aeruginosa isolate paerg000 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | EJN10_RS21645 | Protein ID | WP_003153636.1 |
Coordinates | 4567208..4567783 (-) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | EJN10_RS21650 | Protein ID | WP_003050245.1 |
Coordinates | 4567780..4568250 (-) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EJN10_RS21610 | 4562406..4563131 | - | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
EJN10_RS21615 | 4563170..4563271 | - | 102 | Protein_4161 | nucleotidyltransferase | - |
EJN10_RS21625 | 4564509..4565312 | - | 804 | Protein_4163 | nucleotidyltransferase domain-containing protein | - |
EJN10_RS21630 | 4565312..4565812 | - | 501 | WP_003090159.1 | hypothetical protein | - |
EJN10_RS21635 | 4565809..4566279 | - | 471 | WP_023114496.1 | hypothetical protein | - |
EJN10_RS21640 | 4566276..4567190 | - | 915 | WP_023114497.1 | AAA family ATPase | - |
EJN10_RS21645 | 4567208..4567783 | - | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
EJN10_RS21650 | 4567780..4568250 | - | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
EJN10_RS21655 | 4568454..4568837 | + | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
EJN10_RS21660 | 4568834..4569067 | + | 234 | WP_003090170.1 | TIGR03758 family integrating conjugative element protein | - |
EJN10_RS21665 | 4569084..4569443 | + | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
EJN10_RS21670 | 4569455..4569853 | + | 399 | WP_003050133.1 | TIGR03750 family conjugal transfer protein | - |
EJN10_RS21675 | 4569850..4570542 | + | 693 | WP_003090182.1 | TIGR03746 family integrating conjugative element protein | - |
EJN10_RS21680 | 4570539..4571450 | + | 912 | WP_006226028.1 | TIGR03749 family integrating conjugative element protein | - |
EJN10_RS21685 | 4571440..4572860 | + | 1421 | Protein_4175 | TIGR03752 family integrating conjugative element protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T286201 WP_003153636.1 NZ_LR130528:c4567783-4567208 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT286201 WP_003050245.1 NZ_LR130528:c4568250-4567780 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|