Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 142595..143100 | Replicon | chromosome |
Accession | NZ_LR130528 | ||
Organism | Pseudomonas aeruginosa isolate paerg000 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | EJN10_RS00665 | Protein ID | WP_023114790.1 |
Coordinates | 142595..142876 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | EJN10_RS00670 | Protein ID | WP_003083775.1 |
Coordinates | 142873..143100 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EJN10_RS00640 | 137846..139195 | + | 1350 | WP_124033873.1 | C4-dicarboxylate transporter DctA | - |
EJN10_RS00645 | 139244..139930 | + | 687 | WP_124033874.1 | FadR family transcriptional regulator | - |
EJN10_RS00650 | 140031..140762 | + | 732 | Protein_129 | GntR family transcriptional regulator | - |
EJN10_RS00655 | 140969..141355 | + | 387 | WP_014602345.1 | aegerolysin family protein | - |
EJN10_RS00660 | 141387..142295 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
EJN10_RS00665 | 142595..142876 | - | 282 | WP_023114790.1 | type II toxin-antitoxin system toxin ParE | Toxin |
EJN10_RS00670 | 142873..143100 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
EJN10_RS00675 | 143276..143896 | - | 621 | WP_003101226.1 | hypothetical protein | - |
EJN10_RS00680 | 143997..144497 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
EJN10_RS00685 | 144570..144911 | + | 342 | WP_003101229.1 | alkylphosphonate utilization protein | - |
EJN10_RS00690 | 144993..146420 | - | 1428 | WP_124033878.1 | GABA permease | - |
EJN10_RS00695 | 146589..148082 | - | 1494 | WP_016263977.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10464.21 Da Isoelectric Point: 10.0014
>T286197 WP_023114790.1 NZ_LR130528:c142876-142595 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDKVEITP
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDKVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|