Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 3256068..3256573 | Replicon | chromosome |
| Accession | NZ_LR130527 | ||
| Organism | Pseudomonas aeruginosa isolate paerg002 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | EJN50_RS15520 | Protein ID | WP_003083773.1 |
| Coordinates | 3256068..3256349 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | EJN50_RS15525 | Protein ID | WP_003083775.1 |
| Coordinates | 3256346..3256573 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EJN50_RS15495 | 3251319..3252668 | + | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
| EJN50_RS15500 | 3252717..3253403 | + | 687 | WP_003083762.1 | FadR family transcriptional regulator | - |
| EJN50_RS15505 | 3253504..3254238 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
| EJN50_RS15510 | 3254442..3254828 | + | 387 | WP_014602345.1 | aegerolysin family protein | - |
| EJN50_RS15515 | 3254860..3255768 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
| EJN50_RS15520 | 3256068..3256349 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| EJN50_RS15525 | 3256346..3256573 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| EJN50_RS15530 | 3256749..3257369 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| EJN50_RS15535 | 3257470..3257970 | + | 501 | WP_003112629.1 | LEA type 2 family protein | - |
| EJN50_RS15540 | 3258043..3258384 | + | 342 | WP_003101229.1 | alkylphosphonate utilization protein | - |
| EJN50_RS15545 | 3258466..3259893 | - | 1428 | WP_003083784.1 | GABA permease | - |
| EJN50_RS15550 | 3260062..3261555 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T286195 WP_003083773.1 NZ_LR130527:c3256349-3256068 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|