Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 857143..857620 Replicon chromosome
Accession NZ_LR130518
Organism Staphylococcus aureus strain BPH2986 isolate BPH2986

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag EW031_RS04315 Protein ID WP_000052078.1
Coordinates 857143..857331 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag EW031_RS04320 Protein ID WP_001059690.1
Coordinates 857360..857620 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW031_RS04285 853184..853654 + 471 WP_000824472.1 hypothetical protein -
EW031_RS04290 853995..854681 + 687 WP_001548082.1 thermonuclease family protein -
EW031_RS04295 855038..855238 + 201 WP_001059082.1 cold-shock protein -
EW031_RS04300 855734..855952 - 219 WP_000005886.1 hypothetical protein -
EW031_RS04305 856014..856298 - 285 WP_001004395.1 hypothetical protein -
EW031_RS04310 856386..856955 - 570 WP_001106654.1 hypothetical protein -
EW031_RS04315 857143..857331 - 189 WP_000052078.1 hypothetical protein Toxin
EW031_RS04320 857360..857620 - 261 WP_001059690.1 hypothetical protein Antitoxin
EW031_RS04325 857961..858164 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
EW031_RS04330 858161..858397 - 237 WP_000368687.1 hypothetical protein -
EW031_RS04335 858622..859203 + 582 WP_001140686.1 phosphoglycerate mutase family protein -
EW031_RS04340 859276..859893 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
EW031_RS04345 860048..860542 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
EW031_RS04350 860941..861363 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
EW031_RS04355 861511..862227 + 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selk / selq 851827..933793 81966
- inside Prophage - clpP / vWbp / selk / selq 826238..933793 107555


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T286179 WP_000052078.1 NZ_LR130518:c857331-857143 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT286179 WP_001059690.1 NZ_LR130518:c857620-857360 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References