Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2345521..2346050 | Replicon | chromosome |
Accession | NZ_LR130515 | ||
Organism | Staphylococcus aureus strain BPH2947 isolate BPH2947 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | EW033_RS12425 | Protein ID | WP_000621175.1 |
Coordinates | 2345521..2345883 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | EW033_RS12430 | Protein ID | WP_000948331.1 |
Coordinates | 2345880..2346050 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW033_RS12400 | 2342500..2343270 | - | 771 | WP_001041103.1 | RNA polymerase sigma factor SigB | - |
EW033_RS12405 | 2343245..2343724 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
EW033_RS12410 | 2343726..2344052 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
EW033_RS12415 | 2344171..2345172 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
EW033_RS12425 | 2345521..2345883 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EW033_RS12430 | 2345880..2346050 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
EW033_RS12435 | 2346135..2347283 | - | 1149 | WP_001281145.1 | alanine racemase | - |
EW033_RS12440 | 2347349..2347708 | - | 360 | WP_000581200.1 | holo-ACP synthase | - |
EW033_RS12445 | 2347712..2348203 | - | 492 | WP_001205910.1 | PH domain-containing protein | - |
EW033_RS12450 | 2348190..2349773 | - | 1584 | WP_129760524.1 | PH domain-containing protein | - |
EW033_RS12455 | 2349766..2350245 | - | 480 | WP_001287088.1 | hypothetical protein | - |
EW033_RS12460 | 2350453..2351013 | - | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T286170 WP_000621175.1 NZ_LR130515:c2345883-2345521 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|