286169

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-doc
Location 2224500..2225125 Replicon chromosome
Accession NZ_LR130515
Organism Staphylococcus aureus strain BPH2947 isolate BPH2947

Toxin (Protein)


Gene name doc Uniprot ID A0A380FZ43
Locus tag EW033_RS11795 Protein ID WP_001179607.1
Coordinates 2224500..2224895 (-) Length 132 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A380FXS4
Locus tag EW033_RS11800 Protein ID WP_000258939.1
Coordinates 2224895..2225125 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW033_RS11760 2220179..2220721 - 543 WP_000627290.1 streptothricin N-acetyltransferase Sat4 -
EW033_RS11765 2220718..2221353 - 636 Protein_2177 aminoglycoside 6-adenylyltransferase -
EW033_RS11770 2221568..2222290 - 723 WP_001043218.1 hypothetical protein -
EW033_RS11775 2222399..2223199 - 801 WP_000686449.1 metallophosphoesterase -
EW033_RS11780 2223203..2223697 - 495 WP_000280790.1 hypothetical protein -
EW033_RS11785 2223754..2224023 - 270 WP_000755772.1 hypothetical protein -
EW033_RS11790 2224007..2224198 - 192 WP_032605691.1 hypothetical protein -
EW033_RS11795 2224500..2224895 - 396 WP_001179607.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
EW033_RS11800 2224895..2225125 - 231 WP_000258939.1 addiction module antitoxin Antitoxin
EW033_RS11805 2225301..2225822 - 522 WP_000639078.1 metallophosphoesterase -
EW033_RS11810 2225822..2226472 - 651 WP_000411528.1 hypothetical protein -
EW033_RS11815 2226472..2226789 - 318 WP_001807410.1 hypothetical protein -
EW033_RS11820 2226782..2227507 - 726 WP_000197304.1 metallophosphoesterase -
EW033_RS11825 2227507..2227728 - 222 WP_000829423.1 hypothetical protein -
EW033_RS11830 2227748..2227933 - 186 WP_129760514.1 hypothetical protein -
EW033_RS11835 2227917..2228459 - 543 WP_000858632.1 hypothetical protein -
EW033_RS11840 2228474..2228746 - 273 WP_000691100.1 hypothetical protein -
EW033_RS11845 2228772..2228927 - 156 WP_000792995.1 transcriptional regulator -
EW033_RS16385 2229041..2229208 - 168 WP_000312832.1 hypothetical protein -
EW033_RS11850 2229224..2229409 - 186 WP_001187008.1 hypothetical protein -
EW033_RS11855 2229394..2229573 - 180 WP_000401832.1 hypothetical protein -
EW033_RS11860 2229587..2230069 - 483 WP_000833764.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2221568..2314141 92573


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-129)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 15035.51 Da        Isoelectric Point: 9.4574

>T286169 WP_001179607.1 NZ_LR130515:c2224895-2224500 [Staphylococcus aureus]
MQNIKYLTEKQVIAINVKAIQELSPKEQVGVKVPEVLNATIEGVKQSFGGVELYETIERKAAFIYRNIAQKHAFFNANKR
TAFTSMVIFLKLNKINFNCTQDEAVQFTLKVVEDKTLTLEDIADWIKRHCK

Download         Length: 396 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8617.73 Da        Isoelectric Point: 4.4501

>AT286169 WP_000258939.1 NZ_LR130515:c2225125-2224895 [Staphylococcus aureus]
MVTTRKLRRAGNSSVVSVPTEVIAALGVTNGDNLKFNIEDNKVTIEKEVNEDEEFFKLLDETFTEYNQALRKLVDI

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A380FZ43

Antitoxin

Source ID Structure
AlphaFold DB A0A380FXS4

References