Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | TscAT/- |
| Location | 960676..961181 | Replicon | chromosome |
| Accession | NZ_LR130515 | ||
| Organism | Staphylococcus aureus strain BPH2947 isolate BPH2947 | ||
Toxin (Protein)
| Gene name | TscT | Uniprot ID | A0A0C6E6D5 |
| Locus tag | EW033_RS05025 | Protein ID | WP_001103946.1 |
| Coordinates | 960888..961181 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | TscA | Uniprot ID | X5IA75 |
| Locus tag | EW033_RS05020 | Protein ID | WP_001058492.1 |
| Coordinates | 960676..960885 (+) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW033_RS04985 | 956193..957413 | - | 1221 | WP_000264182.1 | site-specific integrase | - |
| EW033_RS04990 | 957501..958229 | - | 729 | WP_000733773.1 | staphylococcal enterotoxin type K | - |
| EW033_RS04995 | 958253..958981 | - | 729 | WP_001033317.1 | staphylococcal enterotoxin type Q | - |
| EW033_RS05000 | 959156..959890 | - | 735 | WP_000142630.1 | helix-turn-helix domain-containing protein | - |
| EW033_RS05005 | 960040..960252 | + | 213 | WP_001063624.1 | helix-turn-helix transcriptional regulator | - |
| EW033_RS05010 | 960253..960525 | + | 273 | WP_001138298.1 | helix-turn-helix domain-containing protein | - |
| EW033_RS05015 | 960537..960683 | + | 147 | WP_000784885.1 | hypothetical protein | - |
| EW033_RS05020 | 960676..960885 | + | 210 | WP_001058492.1 | hypothetical protein | Antitoxin |
| EW033_RS05025 | 960888..961181 | + | 294 | WP_001103946.1 | DUF1474 family protein | Toxin |
| EW033_RS05030 | 961269..962138 | + | 870 | WP_001002691.1 | primase alpha helix C-terminal domain-containing protein | - |
| EW033_RS05035 | 962155..963612 | + | 1458 | WP_000432707.1 | virulence-associated E family protein | - |
| EW033_RS05040 | 963914..964276 | + | 363 | WP_001039172.1 | hypothetical protein | - |
| EW033_RS05045 | 964278..964562 | + | 285 | WP_000998180.1 | hypothetical protein | - |
| EW033_RS05050 | 964559..965200 | + | 642 | WP_001019783.1 | hypothetical protein | - |
| EW033_RS05055 | 965649..965990 | + | 342 | WP_001190616.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | selk / selq | 956193..968304 | 12111 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11590.08 Da Isoelectric Point: 4.9594
>T286163 WP_001103946.1 NZ_LR130515:960888-961181 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASLQADQSESNA
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASLQADQSESNA
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0C6E6D5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | X5IA75 |