Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 943559..944036 Replicon chromosome
Accession NZ_LR130515
Organism Staphylococcus aureus strain BPH2947 isolate BPH2947

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag EW033_RS04880 Protein ID WP_000052078.1
Coordinates 943559..943747 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag EW033_RS04885 Protein ID WP_001059690.1
Coordinates 943776..944036 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW033_RS04850 939599..940069 + 471 WP_000824472.1 hypothetical protein -
EW033_RS04855 940410..941096 + 687 WP_001548082.1 thermonuclease family protein -
EW033_RS04860 941453..941653 + 201 WP_001059082.1 cold-shock protein -
EW033_RS04865 942150..942368 - 219 WP_000005886.1 hypothetical protein -
EW033_RS04870 942430..942714 - 285 WP_001004395.1 hypothetical protein -
EW033_RS04875 942802..943371 - 570 WP_001106654.1 hypothetical protein -
EW033_RS04880 943559..943747 - 189 WP_000052078.1 hypothetical protein Toxin
EW033_RS04885 943776..944036 - 261 WP_001059690.1 hypothetical protein Antitoxin
EW033_RS04890 944377..944580 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
EW033_RS04895 944577..944813 - 237 WP_000368687.1 hypothetical protein -
EW033_RS04900 945038..945619 + 582 WP_001140686.1 phosphoglycerate mutase family protein -
EW033_RS04905 945692..946309 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
EW033_RS04910 946464..946958 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
EW033_RS04915 947357..947779 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
EW033_RS04920 947927..948643 + 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T286162 WP_000052078.1 NZ_LR130515:c943747-943559 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT286162 WP_001059690.1 NZ_LR130515:c944036-943776 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References