Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2141749..2142278 | Replicon | chromosome |
Accession | NZ_LR130513 | ||
Organism | Staphylococcus aureus strain BPH2900 isolate BPH2900 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | EW029_RS10970 | Protein ID | WP_000621175.1 |
Coordinates | 2141749..2142111 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | EW029_RS10975 | Protein ID | WP_000948330.1 |
Coordinates | 2142108..2142278 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW029_RS10945 | 2138727..2139497 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
EW029_RS10950 | 2139472..2139951 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
EW029_RS10955 | 2139953..2140279 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
EW029_RS10960 | 2140399..2141400 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
EW029_RS10970 | 2141749..2142111 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EW029_RS10975 | 2142108..2142278 | - | 171 | WP_000948330.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
EW029_RS10980 | 2142363..2143511 | - | 1149 | WP_129654717.1 | alanine racemase | - |
EW029_RS10985 | 2143577..2143936 | - | 360 | WP_000581193.1 | holo-ACP synthase | - |
EW029_RS10990 | 2143940..2144431 | - | 492 | WP_001205918.1 | PH domain-containing protein | - |
EW029_RS10995 | 2144418..2146001 | - | 1584 | WP_001294624.1 | PH domain-containing protein | - |
EW029_RS11000 | 2145994..2146473 | - | 480 | WP_001287080.1 | hypothetical protein | - |
EW029_RS11005 | 2146682..2147242 | - | 561 | WP_001092400.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T286155 WP_000621175.1 NZ_LR130513:c2142111-2141749 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|