Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 1926290..1927066 | Replicon | chromosome |
| Accession | NZ_LR130513 | ||
| Organism | Staphylococcus aureus strain BPH2900 isolate BPH2900 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | - |
| Locus tag | EW029_RS09600 | Protein ID | WP_000031112.1 |
| Coordinates | 1926290..1926442 (-) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | W8U4V4 |
| Locus tag | EW029_RS09605 | Protein ID | WP_001251224.1 |
| Coordinates | 1926467..1927066 (-) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW029_RS09585 | 1922196..1923017 | + | 822 | WP_000669382.1 | RluA family pseudouridine synthase | - |
| EW029_RS09590 | 1923479..1924864 | - | 1386 | WP_000116232.1 | class II fumarate hydratase | - |
| EW029_RS09595 | 1925060..1925455 | - | 396 | WP_000901023.1 | hypothetical protein | - |
| EW029_RS09600 | 1926290..1926442 | - | 153 | WP_000031112.1 | hypothetical protein | Toxin |
| EW029_RS09605 | 1926467..1927066 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| EW029_RS09610 | 1927225..1927695 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| EW029_RS09615 | 1927700..1928827 | - | 1128 | WP_000379980.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| EW029_RS09620 | 1928977..1929699 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
| EW029_RS09625 | 1929692..1931149 | - | 1458 | WP_000649910.1 | ABC transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5966.31 Da Isoelectric Point: 3.8962
>T286152 WP_000031112.1 NZ_LR130513:c1926442-1926290 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELSKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELSKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT286152 WP_001251224.1 NZ_LR130513:c1927066-1926467 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|