Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 830417..830894 Replicon chromosome
Accession NZ_LR130513
Organism Staphylococcus aureus strain BPH2900 isolate BPH2900

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag EW029_RS04010 Protein ID WP_000052076.1
Coordinates 830417..830605 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag EW029_RS04015 Protein ID WP_001059690.1
Coordinates 830634..830894 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW029_RS03980 826407..826928 + 522 WP_000824488.1 hypothetical protein -
EW029_RS03985 827269..827955 + 687 WP_001670297.1 thermonuclease family protein -
EW029_RS03990 828312..828512 + 201 WP_001059082.1 cold-shock protein -
EW029_RS03995 829008..829226 - 219 WP_000005876.1 hypothetical protein -
EW029_RS04000 829288..829572 - 285 WP_001004395.1 hypothetical protein -
EW029_RS04005 829660..830229 - 570 WP_001106646.1 hypothetical protein -
EW029_RS04010 830417..830605 - 189 WP_000052076.1 hypothetical protein Toxin
EW029_RS04015 830634..830894 - 261 WP_001059690.1 hypothetical protein Antitoxin
EW029_RS04020 831234..831437 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
EW029_RS04025 831434..831670 - 237 WP_000368687.1 hypothetical protein -
EW029_RS04030 831895..832476 + 582 WP_001140696.1 phosphoglycerate mutase family protein -
EW029_RS04035 832549..833166 - 618 WP_000255559.1 LysE/ArgO family amino acid transporter -
EW029_RS04040 833320..833814 - 495 WP_000590539.1 GNAT family N-acetyltransferase -
EW029_RS04045 834213..834635 - 423 WP_000974455.1 organic hydroperoxide resistance protein -
EW029_RS04050 834783..835499 + 717 WP_000150015.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T286145 WP_000052076.1 NZ_LR130513:c830605-830417 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT286145 WP_001059690.1 NZ_LR130513:c830894-830634 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References