Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2049064..2049593 | Replicon | chromosome |
| Accession | NZ_LR130511 | ||
| Organism | Staphylococcus aureus strain BPH2819 isolate BPH2819 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | EW030_RS10515 | Protein ID | WP_000621175.1 |
| Coordinates | 2049064..2049426 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | EW030_RS10520 | Protein ID | WP_000948331.1 |
| Coordinates | 2049423..2049593 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW030_RS10490 | 2046042..2046812 | - | 771 | WP_001041111.1 | RNA polymerase sigma factor SigB | - |
| EW030_RS10495 | 2046787..2047266 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| EW030_RS10500 | 2047268..2047594 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| EW030_RS10505 | 2047713..2048714 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| EW030_RS10515 | 2049064..2049426 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EW030_RS10520 | 2049423..2049593 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| EW030_RS10525 | 2049678..2050826 | - | 1149 | WP_001281154.1 | alanine racemase | - |
| EW030_RS10530 | 2050892..2051251 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
| EW030_RS10535 | 2051255..2051746 | - | 492 | WP_001205912.1 | PH domain-containing protein | - |
| EW030_RS10540 | 2051733..2053316 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
| EW030_RS10545 | 2053309..2053788 | - | 480 | WP_001287087.1 | hypothetical protein | - |
| EW030_RS10550 | 2053996..2054556 | - | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T286138 WP_000621175.1 NZ_LR130511:c2049426-2049064 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|