Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2039800..2040329 | Replicon | chromosome |
| Accession | NZ_LR130509 | ||
| Organism | Staphylococcus aureus strain BPH2760 isolate BPH2760 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | EW032_RS10400 | Protein ID | WP_000621175.1 |
| Coordinates | 2039800..2040162 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | EW032_RS10405 | Protein ID | WP_000948331.1 |
| Coordinates | 2040159..2040329 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW032_RS10375 | 2036778..2037548 | - | 771 | WP_001041108.1 | RNA polymerase sigma factor SigB | - |
| EW032_RS10380 | 2037523..2038002 | - | 480 | WP_001190830.1 | anti-sigma B factor RsbW | - |
| EW032_RS10385 | 2038004..2038330 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| EW032_RS10390 | 2038449..2039450 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| EW032_RS10400 | 2039800..2040162 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EW032_RS10405 | 2040159..2040329 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| EW032_RS10410 | 2040414..2041562 | - | 1149 | WP_001281154.1 | alanine racemase | - |
| EW032_RS10415 | 2041628..2041987 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
| EW032_RS10420 | 2041991..2042482 | - | 492 | WP_001205912.1 | PH domain-containing protein | - |
| EW032_RS10425 | 2042469..2044052 | - | 1584 | WP_063456354.1 | PH domain-containing protein | - |
| EW032_RS10430 | 2044045..2044524 | - | 480 | WP_001287078.1 | hypothetical protein | - |
| EW032_RS10435 | 2044733..2045293 | - | 561 | WP_001092409.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T286126 WP_000621175.1 NZ_LR130509:c2040162-2039800 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|