Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1883129..1883905 | Replicon | chromosome |
Accession | NZ_LR130509 | ||
Organism | Staphylococcus aureus strain BPH2760 isolate BPH2760 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | EW032_RS09450 | Protein ID | WP_000031108.1 |
Coordinates | 1883129..1883281 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | EW032_RS09455 | Protein ID | WP_001251224.1 |
Coordinates | 1883306..1883905 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW032_RS09430 | 1879265..1880086 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
EW032_RS09435 | 1880547..1881932 | - | 1386 | WP_000116229.1 | class II fumarate hydratase | - |
EW032_RS09440 | 1882128..1882523 | - | 396 | WP_000901023.1 | hypothetical protein | - |
EW032_RS09450 | 1883129..1883281 | - | 153 | WP_000031108.1 | hypothetical protein | Toxin |
EW032_RS09455 | 1883306..1883905 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
EW032_RS09460 | 1884064..1884534 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
EW032_RS09465 | 1884539..1885666 | - | 1128 | WP_000379987.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
EW032_RS09470 | 1885817..1886539 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
EW032_RS09475 | 1886532..1887989 | - | 1458 | WP_129621264.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T286125 WP_000031108.1 NZ_LR130509:c1883281-1883129 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT286125 WP_001251224.1 NZ_LR130509:c1883905-1883306 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|