Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 843611..844088 Replicon chromosome
Accession NZ_LR130509
Organism Staphylococcus aureus strain BPH2760 isolate BPH2760

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag EW032_RS04250 Protein ID WP_000052076.1
Coordinates 843611..843799 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag EW032_RS04255 Protein ID WP_001059690.1
Coordinates 843828..844088 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW032_RS04220 839601..840122 + 522 WP_000824464.1 hypothetical protein -
EW032_RS04225 840463..841149 + 687 WP_001793574.1 thermonuclease family protein -
EW032_RS04230 841506..841706 + 201 WP_001059082.1 cold-shock protein -
EW032_RS04235 842202..842420 - 219 WP_000005886.1 hypothetical protein -
EW032_RS04240 842482..842766 - 285 WP_001004401.1 hypothetical protein -
EW032_RS04245 842854..843423 - 570 WP_001106654.1 hypothetical protein -
EW032_RS04250 843611..843799 - 189 WP_000052076.1 hypothetical protein Toxin
EW032_RS04255 843828..844088 - 261 WP_001059690.1 hypothetical protein Antitoxin
EW032_RS04260 844428..844631 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
EW032_RS04265 844628..844864 - 237 WP_000368687.1 hypothetical protein -
EW032_RS04270 845088..845669 + 582 WP_001140696.1 phosphoglycerate mutase family protein -
EW032_RS04275 845742..846359 - 618 WP_000255544.1 LysE/ArgO family amino acid transporter -
EW032_RS04280 846514..847008 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
EW032_RS04285 847407..847829 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
EW032_RS04290 847977..848693 + 717 WP_000150012.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T286123 WP_000052076.1 NZ_LR130509:c843799-843611 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT286123 WP_001059690.1 NZ_LR130509:c844088-843828 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References