Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 372150..372661 Replicon chromosome
Accession NZ_LR130509
Organism Staphylococcus aureus strain BPH2760 isolate BPH2760

Toxin (Protein)


Gene name TscT Uniprot ID X5IG98
Locus tag EW032_RS01800 Protein ID WP_050961496.1
Coordinates 372362..372661 (+) Length 100 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID X5IA75
Locus tag EW032_RS01795 Protein ID WP_001058492.1
Coordinates 372150..372359 (+) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW032_RS01755 367218..367721 + 504 WP_000934799.1 single-stranded DNA-binding protein -
EW032_RS01760 367773..368015 + 243 WP_000897044.1 30S ribosomal protein S18 -
EW032_RS01765 368131..369237 - 1107 WP_000715303.1 Abi family protein -
EW032_RS01770 369418..370629 - 1212 WP_033854764.1 site-specific integrase -
EW032_RS01775 370790..371413 - 624 WP_033854765.1 transcriptional regulator -
EW032_RS01780 371562..371726 + 165 WP_033854775.1 helix-turn-helix domain-containing protein -
EW032_RS01785 371727..371999 + 273 WP_033854766.1 hypothetical protein -
EW032_RS01790 372011..372157 + 147 WP_000784888.1 hypothetical protein -
EW032_RS01795 372150..372359 + 210 WP_001058492.1 hypothetical protein Antitoxin
EW032_RS01800 372362..372661 + 300 WP_050961496.1 DUF1474 family protein Toxin
EW032_RS01805 372736..374349 + 1614 WP_129621085.1 phage resistance protein -
EW032_RS01810 374520..375323 + 804 WP_000148371.1 bifunctional DNA primase/polymerase -
EW032_RS01815 375310..375582 + 273 WP_001149387.1 hypothetical protein -
EW032_RS01820 375584..376225 + 642 WP_001019773.1 hypothetical protein -
EW032_RS01825 376675..377016 + 342 WP_001190606.1 hypothetical protein -
EW032_RS01830 377028..377606 + 579 WP_000846280.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 367218..388455 21237


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-90)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 100 a.a.        Molecular weight: 11666.17 Da        Isoelectric Point: 4.6685

>T286122 WP_050961496.1 NZ_LR130509:372362-372661 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKEKINDVAIKHGWFVEDKFVKNKLETKQEHISYSAGYLEHRIQNEHTVELLQVYLKEFGELIQRF
HEIEKASSDVSLATESDDA

Download         Length: 300 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8238.28 Da        Isoelectric Point: 4.3718

>AT286122 WP_001058492.1 NZ_LR130509:372150-372359 [Staphylococcus aureus]
MNNEQKEVIEHVVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB X5IG98

Antitoxin

Source ID Structure
AlphaFold DB X5IA75

References