Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 1802991..1803477 Replicon chromosome
Accession NZ_LR130240
Organism Streptococcus pyogenes strain PS006 isolate PS006

Toxin (Protein)


Gene name relE Uniprot ID Q48QR0
Locus tag EW022_RS09065 Protein ID WP_014407961.1
Coordinates 1802991..1803260 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A660A1J7
Locus tag EW022_RS09070 Protein ID WP_014407962.1
Coordinates 1803250..1803477 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW022_RS09050 1798486..1799559 + 1074 WP_011285298.1 DUF4097 family beta strand repeat protein -
EW022_RS09055 1799676..1801949 - 2274 WP_021340697.1 YhgE/Pip domain-containing protein -
EW022_RS09060 1802084..1802617 + 534 WP_010922785.1 TetR/AcrR family transcriptional regulator -
EW022_RS09065 1802991..1803260 - 270 WP_014407961.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
EW022_RS09070 1803250..1803477 - 228 WP_014407962.1 hypothetical protein Antitoxin
EW022_RS09075 1803630..1804001 - 372 WP_011285302.1 DUF1492 domain-containing protein -
EW022_RS09080 1803991..1804338 - 348 WP_011285303.1 DUF1492 domain-containing protein -
EW022_RS09085 1804619..1804864 - 246 WP_011285304.1 hypothetical protein -
EW022_RS09090 1804839..1805114 - 276 WP_014407964.1 hypothetical protein -
EW022_RS09095 1805104..1805442 - 339 WP_030126557.1 replication protein -
EW022_RS09100 1805484..1805750 - 267 WP_011285307.1 hypothetical protein -
EW022_RS09105 1805747..1806535 - 789 WP_011285308.1 hypothetical protein -
EW022_RS09480 1806626..1806784 - 159 WP_011285309.1 hypothetical protein -
EW022_RS09110 1806798..1807043 - 246 WP_011285310.1 hypothetical protein -
EW022_RS09115 1807039..1807365 - 327 Protein_1688 hypothetical protein -
EW022_RS09485 1807367..1807540 - 174 WP_011285312.1 hypothetical protein -
EW022_RS09120 1807546..1807719 - 174 WP_000694580.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-87)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10497.50 Da        Isoelectric Point: 10.5027

>T286121 WP_014407961.1 NZ_LR130240:c1803260-1802991 [Streptococcus pyogenes]
MTYKLVVSDEVKKQLKKMDKHVGLMLAKDMKKRLDGLNNPRQFGKALTGQYKGLWRYRVGNYRVICDIVDNEMIILALEV
GHRKEIYKR

Download         Length: 270 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8641.63 Da        Isoelectric Point: 3.9607

>AT286121 WP_014407962.1 NZ_LR130240:c1803477-1803250 [Streptococcus pyogenes]
MAMVSLRLNSAEEELFRSYATHTGKTLSELFKTALAQQIEDQLDYETGIQALKRFEENPITYSIDDLIEELENDL

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A660A202

Antitoxin

Source ID Structure
AlphaFold DB A0A660A1J7

References