Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 1666880..1667492 Replicon chromosome
Accession NZ_LR130239
Organism Streptococcus pyogenes strain PS003 isolate PS003

Toxin (Protein)


Gene name parE Uniprot ID A0A4Z2JY48
Locus tag EW023_RS08520 Protein ID WP_002982731.1
Coordinates 1667157..1667492 (+) Length 112 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q5X9X9
Locus tag EW023_RS08515 Protein ID WP_002988079.1
Coordinates 1666880..1667167 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW023_RS08490 1662058..1663041 - 984 WP_023611854.1 tagatose-bisphosphate aldolase -
EW023_RS08495 1663045..1663974 - 930 WP_023611874.1 tagatose-6-phosphate kinase -
EW023_RS08500 1664022..1664537 - 516 WP_014407849.1 galactose-6-phosphate isomerase subunit LacB -
EW023_RS08505 1664572..1665000 - 429 WP_011529004.1 galactose-6-phosphate isomerase subunit LacA -
EW023_RS08510 1665446..1666219 + 774 WP_002993783.1 DeoR/GlpR family DNA-binding transcription regulator -
EW023_RS08515 1666880..1667167 + 288 WP_002988079.1 DNA-damage-inducible protein J Antitoxin
EW023_RS08520 1667157..1667492 + 336 WP_002982731.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
EW023_RS09765 1667644..1668114 + 471 Protein_1569 tyrosine-type recombinase/integrase family protein -
EW023_RS09770 1668476..1668577 + 102 WP_180372495.1 hypothetical protein -
EW023_RS08540 1668757..1669149 - 393 WP_002982716.1 30S ribosomal protein S9 -
EW023_RS08545 1669170..1669616 - 447 WP_002982710.1 50S ribosomal protein L13 -
EW023_RS08550 1669834..1670040 - 207 WP_023611859.1 helix-turn-helix transcriptional regulator -
EW023_RS08555 1670037..1670735 - 699 WP_023611871.1 hypothetical protein -
EW023_RS08560 1670871..1671731 - 861 WP_023611214.1 DegV family protein -
EW023_RS08565 1671828..1672346 - 519 WP_002982682.1 NYN domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-105)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 13145.88 Da        Isoelectric Point: 5.2144

>T286120 WP_002982731.1 NZ_LR130239:1667157-1667492 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK

Download         Length: 336 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10934.56 Da        Isoelectric Point: 5.2318

>AT286120 WP_002988079.1 NZ_LR130239:1666880-1667167 [Streptococcus pyogenes]
MTTVKKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVVVTNEVDLLTEEELEKEKLFKQFQAEINKNIEDVRQ
GKFYTSEEVRAELGL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4Z2JY48

Antitoxin

Source ID Structure
AlphaFold DB A0A4U7GX94

References