Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 264594..265206 Replicon chromosome
Accession NZ_LR130238
Organism Streptococcus pyogenes strain HKU419 isolate HKU419

Toxin (Protein)


Gene name parE Uniprot ID J7M9F1
Locus tag EW025_RS01480 Protein ID WP_010922665.1
Coordinates 264594..264929 (-) Length 112 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q5X9X9
Locus tag EW025_RS01485 Protein ID WP_002988079.1
Coordinates 264919..265206 (-) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW025_RS01445 259972..260490 + 519 WP_002982682.1 NYN domain-containing protein -
EW025_RS01450 260587..261447 + 861 WP_002982687.1 DegV family protein -
EW025_RS01455 261583..262089 + 507 WP_002988070.1 hypothetical protein -
EW025_RS01460 262086..262292 + 207 WP_002982695.1 helix-turn-helix transcriptional regulator -
EW025_RS01465 262510..262956 + 447 WP_049524804.1 50S ribosomal protein L13 -
EW025_RS01470 262977..263369 + 393 WP_002982716.1 30S ribosomal protein S9 -
EW025_RS10220 263489..263926 - 438 WP_076639988.1 site-specific integrase -
EW025_RS10225 263972..264442 - 471 Protein_231 integrase -
EW025_RS01480 264594..264929 - 336 WP_010922665.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
EW025_RS01485 264919..265206 - 288 WP_002988079.1 DNA-damage-inducible protein J Antitoxin
EW025_RS01495 265867..266640 - 774 WP_002982738.1 DeoR/GlpR family DNA-binding transcription regulator -
EW025_RS01500 267087..267515 + 429 WP_010922664.1 galactose-6-phosphate isomerase subunit LacA -
EW025_RS01505 267550..268065 + 516 WP_002988082.1 galactose-6-phosphate isomerase subunit LacB -
EW025_RS01510 268113..269042 + 930 WP_010922663.1 tagatose-6-phosphate kinase -
EW025_RS01515 269046..270029 + 984 WP_002982755.1 tagatose-bisphosphate aldolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-105)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 13185.99 Da        Isoelectric Point: 5.2144

>T286119 WP_010922665.1 NZ_LR130238:c264929-264594 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIIHYHSTKGYTLSKD
YIVLYHIEGEENRIVIDYLLPTQSDYIKLFK

Download         Length: 336 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10934.56 Da        Isoelectric Point: 5.2318

>AT286119 WP_002988079.1 NZ_LR130238:c265206-264919 [Streptococcus pyogenes]
MTTVKKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVVVTNEVDLLTEEELEKEKLFKQFQAEINKNIEDVRQ
GKFYTSEEVRAELGL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB J7M9F1

Antitoxin

Source ID Structure
AlphaFold DB A0A4U7GX94

References