Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 1584512..1585124 Replicon chromosome
Accession NZ_LR130237
Organism Streptococcus pyogenes strain SP444 isolate SP444

Toxin (Protein)


Gene name parE Uniprot ID Q1JJZ2
Locus tag EW024_RS08095 Protein ID WP_002988077.1
Coordinates 1584789..1585124 (+) Length 112 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q5X9X9
Locus tag EW024_RS08090 Protein ID WP_002988079.1
Coordinates 1584512..1584799 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW024_RS08065 1579701..1580684 - 984 WP_011529001.1 tagatose-bisphosphate aldolase -
EW024_RS08070 1580688..1581617 - 930 WP_011529002.1 tagatose-6-phosphate kinase -
EW024_RS08075 1581665..1582180 - 516 WP_011529003.1 galactose-6-phosphate isomerase subunit LacB -
EW024_RS08080 1582215..1582643 - 429 WP_011529004.1 galactose-6-phosphate isomerase subunit LacA -
EW024_RS08085 1583089..1583862 + 774 WP_011529005.1 DeoR/GlpR family DNA-binding transcription regulator -
EW024_RS08090 1584512..1584799 + 288 WP_002988079.1 DNA-damage-inducible protein J Antitoxin
EW024_RS08095 1584789..1585124 + 336 WP_002988077.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
EW024_RS08100 1585263..1585439 + 177 Protein_1482 tyrosine-type recombinase/integrase -
EW024_RS08110 1585570..1585962 - 393 WP_002982716.1 30S ribosomal protein S9 -
EW024_RS08115 1585983..1586429 - 447 WP_002982710.1 50S ribosomal protein L13 -
EW024_RS08120 1586647..1586853 - 207 WP_011529007.1 helix-turn-helix transcriptional regulator -
EW024_RS08125 1586850..1587548 - 699 WP_021299047.1 hypothetical protein -
EW024_RS08130 1587684..1588544 - 861 WP_011529009.1 DegV family protein -
EW024_RS08135 1588641..1589159 - 519 WP_011055010.1 NYN domain-containing protein -
EW024_RS08140 1589163..1589909 - 747 WP_010922667.1 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-105)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 13117.83 Da        Isoelectric Point: 5.2144

>T286118 WP_002988077.1 NZ_LR130237:1584789-1585124 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVAIDYLLPTQSDYIKLFK

Download         Length: 336 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10934.56 Da        Isoelectric Point: 5.2318

>AT286118 WP_002988079.1 NZ_LR130237:1584512-1584799 [Streptococcus pyogenes]
MTTVKKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVVVTNEVDLLTEEELEKEKLFKQFQAEINKNIEDVRQ
GKFYTSEEVRAELGL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A660A236

Antitoxin

Source ID Structure
AlphaFold DB A0A4U7GX94

References