Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1584512..1585124 | Replicon | chromosome |
| Accession | NZ_LR130237 | ||
| Organism | Streptococcus pyogenes strain SP444 isolate SP444 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | Q1JJZ2 |
| Locus tag | EW024_RS08095 | Protein ID | WP_002988077.1 |
| Coordinates | 1584789..1585124 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q5X9X9 |
| Locus tag | EW024_RS08090 | Protein ID | WP_002988079.1 |
| Coordinates | 1584512..1584799 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW024_RS08065 | 1579701..1580684 | - | 984 | WP_011529001.1 | tagatose-bisphosphate aldolase | - |
| EW024_RS08070 | 1580688..1581617 | - | 930 | WP_011529002.1 | tagatose-6-phosphate kinase | - |
| EW024_RS08075 | 1581665..1582180 | - | 516 | WP_011529003.1 | galactose-6-phosphate isomerase subunit LacB | - |
| EW024_RS08080 | 1582215..1582643 | - | 429 | WP_011529004.1 | galactose-6-phosphate isomerase subunit LacA | - |
| EW024_RS08085 | 1583089..1583862 | + | 774 | WP_011529005.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| EW024_RS08090 | 1584512..1584799 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
| EW024_RS08095 | 1584789..1585124 | + | 336 | WP_002988077.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EW024_RS08100 | 1585263..1585439 | + | 177 | Protein_1482 | tyrosine-type recombinase/integrase | - |
| EW024_RS08110 | 1585570..1585962 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
| EW024_RS08115 | 1585983..1586429 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
| EW024_RS08120 | 1586647..1586853 | - | 207 | WP_011529007.1 | helix-turn-helix transcriptional regulator | - |
| EW024_RS08125 | 1586850..1587548 | - | 699 | WP_021299047.1 | hypothetical protein | - |
| EW024_RS08130 | 1587684..1588544 | - | 861 | WP_011529009.1 | DegV family protein | - |
| EW024_RS08135 | 1588641..1589159 | - | 519 | WP_011055010.1 | NYN domain-containing protein | - |
| EW024_RS08140 | 1589163..1589909 | - | 747 | WP_010922667.1 | 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13117.83 Da Isoelectric Point: 5.2144
>T286118 WP_002988077.1 NZ_LR130237:1584789-1585124 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVAIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVAIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A660A236 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4U7GX94 |