Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 258533..259145 | Replicon | chromosome |
| Accession | NZ_LR130236 | ||
| Organism | Streptococcus pyogenes strain 5448 isolate 5448 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | J7M9F1 |
| Locus tag | EW021_RS01415 | Protein ID | WP_010922665.1 |
| Coordinates | 258533..258868 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q5X9X9 |
| Locus tag | EW021_RS01420 | Protein ID | WP_002988079.1 |
| Coordinates | 258858..259145 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW021_RS01380 | 253911..254429 | + | 519 | WP_002982682.1 | NYN domain-containing protein | - |
| EW021_RS01385 | 254526..255386 | + | 861 | WP_002982687.1 | DegV family protein | - |
| EW021_RS01390 | 255522..256028 | + | 507 | WP_002988070.1 | hypothetical protein | - |
| EW021_RS01395 | 256025..256231 | + | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
| EW021_RS01400 | 256449..256895 | + | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
| EW021_RS01405 | 256916..257308 | + | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
| EW021_RS09495 | 257428..257865 | - | 438 | WP_076639988.1 | site-specific integrase | - |
| EW021_RS09500 | 257911..258381 | - | 471 | Protein_231 | integrase | - |
| EW021_RS01415 | 258533..258868 | - | 336 | WP_010922665.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EW021_RS01420 | 258858..259145 | - | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
| EW021_RS01430 | 259806..260579 | - | 774 | WP_002982738.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| EW021_RS01435 | 261026..261454 | + | 429 | WP_010922664.1 | galactose-6-phosphate isomerase subunit LacA | - |
| EW021_RS01440 | 261489..262004 | + | 516 | WP_002988082.1 | galactose-6-phosphate isomerase subunit LacB | - |
| EW021_RS01445 | 262052..262981 | + | 930 | WP_010922663.1 | tagatose-6-phosphate kinase | - |
| EW021_RS01450 | 262985..263968 | + | 984 | WP_002982755.1 | tagatose-bisphosphate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13185.99 Da Isoelectric Point: 5.2144
>T286117 WP_010922665.1 NZ_LR130236:c258868-258533 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIIHYHSTKGYTLSKD
YIVLYHIEGEENRIVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIIHYHSTKGYTLSKD
YIVLYHIEGEENRIVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | J7M9F1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4U7GX94 |