Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1583051..1583719 Replicon chromosome
Accession NZ_LR129843
Organism Streptococcus pneumoniae strain 180-2 isolate 180-2

Toxin (Protein)


Gene name hicA Uniprot ID B1I7Q0
Locus tag EQB46_RS08540 Protein ID WP_001132285.1
Coordinates 1583540..1583719 (-) Length 60 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A4J1XUY0
Locus tag EQB46_RS08535 Protein ID WP_000961812.1
Coordinates 1583051..1583503 (-) Length 151 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB46_RS08510 1578941..1579684 - 744 WP_001188204.1 16S rRNA (uracil(1498)-N(3))-methyltransferase -
EQB46_RS08515 1579686..1580636 - 951 WP_000451160.1 50S ribosomal protein L11 methyltransferase -
EQB46_RS08520 1580774..1581202 - 429 WP_000418157.1 NUDIX hydrolase -
EQB46_RS08525 1581183..1582271 - 1089 WP_000719712.1 M50 family metallopeptidase -
EQB46_RS08530 1582290..1582760 - 471 WP_000257088.1 DUF3013 family protein -
EQB46_RS08535 1583051..1583503 - 453 WP_000961812.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
EQB46_RS08540 1583540..1583719 - 180 WP_001132285.1 type II toxin-antitoxin system HicA family toxin Toxin
EQB46_RS08545 1583856..1584104 - 249 WP_000797237.1 hypothetical protein -
EQB46_RS08550 1584094..1584333 - 240 WP_000818079.1 hypothetical protein -
EQB46_RS08560 1584603..1585874 + 1272 WP_001113213.1 replication-associated recombination protein A -
EQB46_RS08570 1586294..1587421 - 1128 WP_000323403.1 site-specific integrase -
EQB46_RS08575 1587423..1587605 - 183 WP_000655518.1 DUF3173 domain-containing protein -
EQB46_RS08580 1587621..1588664 - 1044 WP_001031659.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(17-114)


Sequences

Toxin        


Download         Length: 60 a.a.        Molecular weight: 6713.01 Da        Isoelectric Point: 11.2964

>T286113 WP_001132285.1 NZ_LR129843:c1583719-1583540 [Streptococcus pneumoniae]
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERPITILHGKLNKYTERGIRKQAGL

Download         Length: 180 bp

Antitoxin


Download         Length: 151 a.a.        Molecular weight: 16659.46 Da        Isoelectric Point: 3.7220

>AT286113 WP_000961812.1 NZ_LR129843:c1583503-1583051 [Streptococcus pneumoniae]
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGLTVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA

Download         Length: 453 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0T9HEZ5

Antitoxin

Source ID Structure
AlphaFold DB A0A4J1XUY0

References