Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1653777..1654445 | Replicon | chromosome |
| Accession | NZ_LR129841 | ||
| Organism | Streptococcus pneumoniae strain 947 isolate 947 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | B1I7Q0 |
| Locus tag | EQB42_RS08605 | Protein ID | WP_001132285.1 |
| Coordinates | 1654266..1654445 (-) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | G0IC64 |
| Locus tag | EQB42_RS08600 | Protein ID | WP_000961810.1 |
| Coordinates | 1653777..1654229 (-) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQB42_RS08580 | 1650626..1651660 | - | 1035 | WP_000747915.1 | ATP-binding protein | - |
| EQB42_RS08585 | 1651770..1651928 | - | 159 | WP_000401986.1 | 7,8-dihydro-8-oxoguanine-triphosphatase | - |
| EQB42_RS08590 | 1651930..1652997 | - | 1068 | WP_000719723.1 | M50 family metallopeptidase | - |
| EQB42_RS08595 | 1653016..1653486 | - | 471 | WP_000257084.1 | DUF3013 family protein | - |
| EQB42_RS08600 | 1653777..1654229 | - | 453 | WP_000961810.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| EQB42_RS08605 | 1654266..1654445 | - | 180 | WP_001132285.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| EQB42_RS08610 | 1654582..1654761 | - | 180 | WP_001048906.1 | hypothetical protein | - |
| EQB42_RS08620 | 1654926..1655165 | - | 240 | WP_000818078.1 | hypothetical protein | - |
| EQB42_RS08630 | 1655435..1656706 | + | 1272 | WP_001113218.1 | replication-associated recombination protein A | - |
| EQB42_RS08640 | 1657253..1658572 | - | 1320 | WP_000502558.1 | glycoside hydrolase family 32 protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6713.01 Da Isoelectric Point: 11.2964
>T286110 WP_001132285.1 NZ_LR129841:c1654445-1654266 [Streptococcus pneumoniae]
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERPITILHGKLNKYTERGIRKQAGL
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERPITILHGKLNKYTERGIRKQAGL
Download Length: 180 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16659.46 Da Isoelectric Point: 3.7220
>AT286110 WP_000961810.1 NZ_LR129841:c1654229-1653777 [Streptococcus pneumoniae]
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0T9HEZ5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 5YRZ | |
| AlphaFold DB | G0IC64 |