Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicA |
Location | 3420737..3421162 | Replicon | chromosome |
Accession | NC_019779 | ||
Organism | Halothece sp. PCC 7418 (Aphanothece halophytica 7418) |
Toxin (Protein)
Gene name | hicA | Uniprot ID | K9YFN2 |
Locus tag | PCC7418_RS15690 | Protein ID | WP_015227169.1 |
Coordinates | 3420974..3421162 (-) | Length | 63 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | K9YEB2 |
Locus tag | PCC7418_RS15685 | Protein ID | WP_015227168.1 |
Coordinates | 3420737..3420952 (-) | Length | 72 a.a. |
Genomic Context
Location: 3416483..3417631 (1149 bp)
Type: Others
Protein ID: WP_015227162.1
Type: Others
Protein ID: WP_015227162.1
Location: 3417652..3418833 (1182 bp)
Type: Others
Protein ID: WP_015227163.1
Type: Others
Protein ID: WP_015227163.1
Location: 3418966..3419697 (732 bp)
Type: Others
Protein ID: WP_015227164.1
Type: Others
Protein ID: WP_015227164.1
Location: 3420053..3420316 (264 bp)
Type: Others
Protein ID: WP_015227166.1
Type: Others
Protein ID: WP_015227166.1
Location: 3420313..3420537 (225 bp)
Type: Others
Protein ID: WP_015227167.1
Type: Others
Protein ID: WP_015227167.1
Location: 3420737..3420952 (216 bp)
Type: Antitoxin
Protein ID: WP_015227168.1
Type: Antitoxin
Protein ID: WP_015227168.1
Location: 3420974..3421162 (189 bp)
Type: Toxin
Protein ID: WP_015227169.1
Type: Toxin
Protein ID: WP_015227169.1
Location: 3421293..3421568 (276 bp)
Type: Others
Protein ID: WP_015227170.1
Type: Others
Protein ID: WP_015227170.1
Location: 3422035..3422688 (654 bp)
Type: Others
Protein ID: WP_015227171.1
Type: Others
Protein ID: WP_015227171.1
Location: 3422786..3423070 (285 bp)
Type: Others
Protein ID: WP_015227172.1
Type: Others
Protein ID: WP_015227172.1
Location: 3423060..3423356 (297 bp)
Type: Others
Protein ID: WP_015227173.1
Type: Others
Protein ID: WP_015227173.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PCC7418_RS15660 | 3416483..3417631 | + | 1149 | WP_015227162.1 | iron-containing alcohol dehydrogenase family protein | - |
PCC7418_RS15665 | 3417652..3418833 | + | 1182 | WP_015227163.1 | aspartate aminotransferase | - |
PCC7418_RS15670 | 3418966..3419697 | + | 732 | WP_015227164.1 | class I SAM-dependent methyltransferase | - |
PCC7418_RS15675 | 3420053..3420316 | - | 264 | WP_015227166.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
PCC7418_RS15680 | 3420313..3420537 | - | 225 | WP_015227167.1 | hypothetical protein | - |
PCC7418_RS15685 | 3420737..3420952 | - | 216 | WP_015227168.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PCC7418_RS15690 | 3420974..3421162 | - | 189 | WP_015227169.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PCC7418_RS15695 | 3421293..3421568 | - | 276 | WP_015227170.1 | hypothetical protein | - |
PCC7418_RS15700 | 3422035..3422688 | - | 654 | WP_015227171.1 | GIY-YIG nuclease family protein | - |
PCC7418_RS15705 | 3422786..3423070 | - | 285 | WP_015227172.1 | hypothetical protein | - |
PCC7418_RS15710 | 3423060..3423356 | - | 297 | WP_015227173.1 | BrnT family toxin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3418966..3429083 | 10117 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 6976.17 Da Isoelectric Point: 10.9763
>T28611 WP_015227169.1 NC_019779:c3421162-3420974 [Halothece sp. PCC 7418]
MKVKEIIRLIENDGWKLARTKGSHRQYKHPTKRGLVTIPGKPNDDIAPGTENSILKQAGIKK
MKVKEIIRLIENDGWKLARTKGSHRQYKHPTKRGLVTIPGKPNDDIAPGTENSILKQAGIKK
Download Length: 189 bp
>T28611 NC_019779:c3421162-3420974 [Halothece sp. PCC 7418]
ATGAAAGTTAAAGAGATTATCCGCCTTATTGAAAATGATGGGTGGAAACTTGCCAGAACTAAAGGCAGTCATCGTCAGTA
TAAACACCCGACTAAACGGGGCTTAGTCACTATCCCAGGTAAACCTAACGACGATATCGCTCCTGGAACTGAGAATAGTA
TCTTAAAACAAGCTGGAATCAAAAAATAA
ATGAAAGTTAAAGAGATTATCCGCCTTATTGAAAATGATGGGTGGAAACTTGCCAGAACTAAAGGCAGTCATCGTCAGTA
TAAACACCCGACTAAACGGGGCTTAGTCACTATCCCAGGTAAACCTAACGACGATATCGCTCCTGGAACTGAGAATAGTA
TCTTAAAACAAGCTGGAATCAAAAAATAA
Antitoxin
Download Length: 72 a.a. Molecular weight: 7906.00 Da Isoelectric Point: 4.1933
>AT28611 WP_015227168.1 NC_019779:c3420952-3420737 [Halothece sp. PCC 7418]
MNRYLIVIEKTSTGYSAYSPDLLGCVSTGTTIEEVKENMKEAIQFHLEGMKEEGYEIPLPTTTSSFLEVAI
MNRYLIVIEKTSTGYSAYSPDLLGCVSTGTTIEEVKENMKEAIQFHLEGMKEEGYEIPLPTTTSSFLEVAI
Download Length: 216 bp
>AT28611 NC_019779:c3420952-3420737 [Halothece sp. PCC 7418]
ATGAACAGATATTTAATTGTAATTGAAAAAACATCAACGGGATATTCTGCCTATTCTCCAGATTTGCTAGGCTGCGTCTC
CACAGGTACAACAATCGAGGAAGTGAAAGAGAATATGAAAGAAGCGATACAGTTTCATCTCGAAGGGATGAAAGAAGAGG
GCTATGAAATTCCATTGCCAACAACCACTTCTTCATTTTTAGAAGTTGCCATCTAA
ATGAACAGATATTTAATTGTAATTGAAAAAACATCAACGGGATATTCTGCCTATTCTCCAGATTTGCTAGGCTGCGTCTC
CACAGGTACAACAATCGAGGAAGTGAAAGAGAATATGAAAGAAGCGATACAGTTTCATCTCGAAGGGATGAAAGAAGAGG
GCTATGAAATTCCATTGCCAACAACCACTTCTTCATTTTTAGAAGTTGCCATCTAA