Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1707241..1707903 | Replicon | chromosome |
| Accession | NZ_LR129840 | ||
| Organism | Streptococcus pneumoniae strain 4496 isolate 4496 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | EQB41_RS09115 | Protein ID | WP_000192221.1 |
| Coordinates | 1707730..1707903 (-) | Length | 58 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | G0IC64 |
| Locus tag | EQB41_RS09110 | Protein ID | WP_000961810.1 |
| Coordinates | 1707241..1707693 (-) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQB41_RS09090 | 1704090..1705124 | - | 1035 | WP_000747916.1 | ATP-binding protein | - |
| EQB41_RS09095 | 1705234..1705392 | - | 159 | WP_000418159.1 | 7,8-dihydro-8-oxoguanine-triphosphatase | - |
| EQB41_RS09100 | 1705373..1706461 | - | 1089 | WP_000719711.1 | M50 family metallopeptidase | - |
| EQB41_RS09105 | 1706480..1706950 | - | 471 | WP_000257085.1 | DUF3013 family protein | - |
| EQB41_RS09110 | 1707241..1707693 | - | 453 | WP_000961810.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| EQB41_RS09115 | 1707730..1707903 | - | 174 | WP_000192221.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| EQB41_RS09120 | 1708046..1708294 | - | 249 | WP_000797237.1 | hypothetical protein | - |
| EQB41_RS09125 | 1708284..1708523 | - | 240 | WP_000818079.1 | hypothetical protein | - |
| EQB41_RS09135 | 1708793..1710064 | + | 1272 | WP_127820839.1 | replication-associated recombination protein A | - |
| EQB41_RS09145 | 1710609..1711928 | - | 1320 | WP_000502561.1 | glycoside hydrolase family 32 protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 58 a.a. Molecular weight: 6368.47 Da Isoelectric Point: 10.8214
>T286106 WP_000192221.1 NZ_LR129840:c1707903-1707730 [Streptococcus pneumoniae]
MTQKEMVKLLTAHGWIKTRGGKGSHIKIEKQGERPITILHGELNKYTERGIGKQAGL
MTQKEMVKLLTAHGWIKTRGGKGSHIKIEKQGERPITILHGELNKYTERGIGKQAGL
Download Length: 174 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16659.46 Da Isoelectric Point: 3.7220
>AT286106 WP_000961810.1 NZ_LR129840:c1707693-1707241 [Streptococcus pneumoniae]
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|