Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 1644657..1645269 Replicon chromosome
Accession NZ_LR031521
Organism Streptococcus pyogenes strain S119 isolate S119

Toxin (Protein)


Gene name parE Uniprot ID J7M9F1
Locus tag SP119_RS08600 Protein ID WP_010922665.1
Coordinates 1644934..1645269 (+) Length 112 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q5X9X9
Locus tag SP119_RS08595 Protein ID WP_002988079.1
Coordinates 1644657..1644944 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SP119_RS08565 1639834..1640817 - 984 WP_002982755.1 tagatose-bisphosphate aldolase -
SP119_RS08570 1640821..1641750 - 930 WP_010922663.1 tagatose-6-phosphate kinase -
SP119_RS08575 1641798..1642313 - 516 WP_002988082.1 galactose-6-phosphate isomerase subunit LacB -
SP119_RS08580 1642348..1642776 - 429 WP_010922664.1 galactose-6-phosphate isomerase subunit LacA -
SP119_RS08585 1643223..1643996 + 774 WP_002982738.1 DeoR/GlpR family DNA-binding transcription regulator -
SP119_RS08595 1644657..1644944 + 288 WP_002988079.1 DNA-damage-inducible protein J Antitoxin
SP119_RS08600 1644934..1645269 + 336 WP_010922665.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
SP119_RS09840 1645421..1645891 + 471 Protein_1586 integrase -
SP119_RS08610 1645937..1646374 + 438 WP_076639988.1 site-specific integrase -
SP119_RS08615 1646494..1646886 - 393 WP_002982716.1 30S ribosomal protein S9 -
SP119_RS08620 1646907..1647353 - 447 WP_002982710.1 50S ribosomal protein L13 -
SP119_RS08625 1647571..1647777 - 207 WP_002982695.1 helix-turn-helix transcriptional regulator -
SP119_RS08630 1647774..1648280 - 507 WP_002988070.1 hypothetical protein -
SP119_RS08635 1648416..1649276 - 861 WP_002982687.1 DegV family protein -
SP119_RS08640 1649373..1649891 - 519 WP_002982682.1 NYN domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-105)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 13185.99 Da        Isoelectric Point: 5.2144

>T286102 WP_010922665.1 NZ_LR031521:1644934-1645269 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIIHYHSTKGYTLSKD
YIVLYHIEGEENRIVIDYLLPTQSDYIKLFK

Download         Length: 336 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10934.56 Da        Isoelectric Point: 5.2318

>AT286102 WP_002988079.1 NZ_LR031521:1644657-1644944 [Streptococcus pyogenes]
MTTVKKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVVVTNEVDLLTEEELEKEKLFKQFQAEINKNIEDVRQ
GKFYTSEEVRAELGL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB J7M9F1

Antitoxin

Source ID Structure
AlphaFold DB A0A4U7GX94

References