Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2346928..2347457 | Replicon | chromosome |
Accession | NZ_LR027878 | ||
Organism | Staphylococcus aureus strain BPH2003 isolate BPH2003 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | E0E10_RS12465 | Protein ID | WP_000621175.1 |
Coordinates | 2346928..2347290 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | E0E10_RS12470 | Protein ID | WP_000948331.1 |
Coordinates | 2347287..2347457 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0E10_RS12440 | 2343908..2344678 | - | 771 | WP_001041103.1 | RNA polymerase sigma factor SigB | - |
E0E10_RS12445 | 2344653..2345132 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
E0E10_RS12450 | 2345134..2345460 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
E0E10_RS12455 | 2345578..2346579 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
E0E10_RS12465 | 2346928..2347290 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
E0E10_RS12470 | 2347287..2347457 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
E0E10_RS12475 | 2347542..2348690 | - | 1149 | WP_001281145.1 | alanine racemase | - |
E0E10_RS12480 | 2348756..2349115 | - | 360 | WP_000581200.1 | holo-ACP synthase | - |
E0E10_RS12485 | 2349119..2349610 | - | 492 | WP_001205910.1 | PH domain-containing protein | - |
E0E10_RS12490 | 2349597..2351180 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
E0E10_RS12495 | 2351173..2351652 | - | 480 | WP_001287088.1 | hypothetical protein | - |
E0E10_RS12500 | 2351860..2352420 | - | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T286093 WP_000621175.1 NZ_LR027878:c2347290-2346928 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|