Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-doc
Location 2225883..2226508 Replicon chromosome
Accession NZ_LR027878
Organism Staphylococcus aureus strain BPH2003 isolate BPH2003

Toxin (Protein)


Gene name doc Uniprot ID A0A380FZ43
Locus tag E0E10_RS11840 Protein ID WP_001179607.1
Coordinates 2225883..2226278 (-) Length 132 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A380FXS4
Locus tag E0E10_RS11845 Protein ID WP_000258939.1
Coordinates 2226278..2226508 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E0E10_RS11800 2221438..2221878 - 441 Protein_2180 GNAT family N-acetyltransferase -
E0E10_RS11805 2221853..2222104 - 252 WP_002505594.1 hypothetical protein -
E0E10_RS11810 2222101..2222736 - 636 Protein_2182 aminoglycoside 6-adenylyltransferase -
E0E10_RS11815 2222951..2223673 - 723 WP_001043218.1 hypothetical protein -
E0E10_RS11820 2223782..2224582 - 801 WP_000686449.1 metallophosphoesterase -
E0E10_RS11825 2224586..2225080 - 495 WP_000280790.1 hypothetical protein -
E0E10_RS11830 2225137..2225406 - 270 WP_000755772.1 hypothetical protein -
E0E10_RS11835 2225390..2225581 - 192 WP_032605691.1 hypothetical protein -
E0E10_RS11840 2225883..2226278 - 396 WP_001179607.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
E0E10_RS11845 2226278..2226508 - 231 WP_000258939.1 addiction module antitoxin Antitoxin
E0E10_RS11850 2226684..2227205 - 522 WP_000639078.1 metallophosphoesterase -
E0E10_RS11855 2227205..2227855 - 651 WP_000411528.1 hypothetical protein -
E0E10_RS11860 2227855..2228172 - 318 WP_001807410.1 hypothetical protein -
E0E10_RS11865 2228165..2228890 - 726 WP_000197304.1 metallophosphoesterase -
E0E10_RS11870 2228890..2229111 - 222 WP_000829423.1 hypothetical protein -
E0E10_RS11875 2229131..2229316 - 186 WP_129760514.1 hypothetical protein -
E0E10_RS11880 2229300..2229842 - 543 WP_000858632.1 hypothetical protein -
E0E10_RS11885 2229857..2230129 - 273 WP_000691100.1 hypothetical protein -
E0E10_RS11890 2230155..2230310 - 156 WP_000792995.1 transcriptional regulator -
E0E10_RS16435 2230424..2230591 - 168 WP_000312832.1 hypothetical protein -
E0E10_RS11895 2230607..2230792 - 186 WP_001187008.1 hypothetical protein -
E0E10_RS11900 2230777..2230956 - 180 WP_000401832.1 hypothetical protein -
E0E10_RS11905 2230970..2231452 - 483 WP_000833764.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage aac(6')-aph(2'') / aph(3')-III - 2186952..2315523 128571
- inside Prophage - - 2222951..2318643 95692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-129)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 15035.51 Da        Isoelectric Point: 9.4574

>T286092 WP_001179607.1 NZ_LR027878:c2226278-2225883 [Staphylococcus aureus]
MQNIKYLTEKQVIAINVKAIQELSPKEQVGVKVPEVLNATIEGVKQSFGGVELYETIERKAAFIYRNIAQKHAFFNANKR
TAFTSMVIFLKLNKINFNCTQDEAVQFTLKVVEDKTLTLEDIADWIKRHCK

Download         Length: 396 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8617.73 Da        Isoelectric Point: 4.4501

>AT286092 WP_000258939.1 NZ_LR027878:c2226508-2226278 [Staphylococcus aureus]
MVTTRKLRRAGNSSVVSVPTEVIAALGVTNGDNLKFNIEDNKVTIEKEVNEDEEFFKLLDETFTEYNQALRKLVDI

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A380FZ43

Antitoxin

Source ID Structure
AlphaFold DB A0A380FXS4

References