286086

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 959362..959867 Replicon chromosome
Accession NZ_LR027878
Organism Staphylococcus aureus strain BPH2003 isolate BPH2003

Toxin (Protein)


Gene name TscT Uniprot ID A0A0C6E6D5
Locus tag E0E10_RS05025 Protein ID WP_001103946.1
Coordinates 959574..959867 (+) Length 98 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID X5IA75
Locus tag E0E10_RS05020 Protein ID WP_001058492.1
Coordinates 959362..959571 (+) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E0E10_RS04985 954879..956099 - 1221 WP_000264182.1 site-specific integrase -
E0E10_RS04990 956187..956915 - 729 WP_000733773.1 staphylococcal enterotoxin type K -
E0E10_RS04995 956939..957667 - 729 WP_001033317.1 staphylococcal enterotoxin type Q -
E0E10_RS05000 957842..958576 - 735 WP_000142630.1 helix-turn-helix domain-containing protein -
E0E10_RS05005 958726..958938 + 213 WP_001063624.1 helix-turn-helix transcriptional regulator -
E0E10_RS05010 958939..959211 + 273 WP_001138298.1 helix-turn-helix domain-containing protein -
E0E10_RS05015 959223..959369 + 147 WP_000784885.1 hypothetical protein -
E0E10_RS05020 959362..959571 + 210 WP_001058492.1 hypothetical protein Antitoxin
E0E10_RS05025 959574..959867 + 294 WP_001103946.1 DUF1474 family protein Toxin
E0E10_RS05030 959955..960824 + 870 WP_001002691.1 primase alpha helix C-terminal domain-containing protein -
E0E10_RS05035 960841..962298 + 1458 WP_000432707.1 virulence-associated E family protein -
E0E10_RS05040 962600..962962 + 363 WP_001039172.1 hypothetical protein -
E0E10_RS05045 962964..963248 + 285 WP_000998180.1 hypothetical protein -
E0E10_RS05050 963245..963886 + 642 WP_001019783.1 hypothetical protein -
E0E10_RS05055 964335..964676 + 342 WP_001190616.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selk / selq 936928..966990 30062


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-97)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11590.08 Da        Isoelectric Point: 4.9594

>T286086 WP_001103946.1 NZ_LR027878:959574-959867 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASLQADQSESNA

Download         Length: 294 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8238.28 Da        Isoelectric Point: 4.3718

>AT286086 WP_001058492.1 NZ_LR027878:959362-959571 [Staphylococcus aureus]
MNNEQKEVIEHVVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0C6E6D5

Antitoxin

Source ID Structure
AlphaFold DB X5IA75

References