Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | TscAT/- |
| Location | 959362..959867 | Replicon | chromosome |
| Accession | NZ_LR027878 | ||
| Organism | Staphylococcus aureus strain BPH2003 isolate BPH2003 | ||
Toxin (Protein)
| Gene name | TscT | Uniprot ID | A0A0C6E6D5 |
| Locus tag | E0E10_RS05025 | Protein ID | WP_001103946.1 |
| Coordinates | 959574..959867 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | TscA | Uniprot ID | X5IA75 |
| Locus tag | E0E10_RS05020 | Protein ID | WP_001058492.1 |
| Coordinates | 959362..959571 (+) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E10_RS04985 | 954879..956099 | - | 1221 | WP_000264182.1 | site-specific integrase | - |
| E0E10_RS04990 | 956187..956915 | - | 729 | WP_000733773.1 | staphylococcal enterotoxin type K | - |
| E0E10_RS04995 | 956939..957667 | - | 729 | WP_001033317.1 | staphylococcal enterotoxin type Q | - |
| E0E10_RS05000 | 957842..958576 | - | 735 | WP_000142630.1 | helix-turn-helix domain-containing protein | - |
| E0E10_RS05005 | 958726..958938 | + | 213 | WP_001063624.1 | helix-turn-helix transcriptional regulator | - |
| E0E10_RS05010 | 958939..959211 | + | 273 | WP_001138298.1 | helix-turn-helix domain-containing protein | - |
| E0E10_RS05015 | 959223..959369 | + | 147 | WP_000784885.1 | hypothetical protein | - |
| E0E10_RS05020 | 959362..959571 | + | 210 | WP_001058492.1 | hypothetical protein | Antitoxin |
| E0E10_RS05025 | 959574..959867 | + | 294 | WP_001103946.1 | DUF1474 family protein | Toxin |
| E0E10_RS05030 | 959955..960824 | + | 870 | WP_001002691.1 | primase alpha helix C-terminal domain-containing protein | - |
| E0E10_RS05035 | 960841..962298 | + | 1458 | WP_000432707.1 | virulence-associated E family protein | - |
| E0E10_RS05040 | 962600..962962 | + | 363 | WP_001039172.1 | hypothetical protein | - |
| E0E10_RS05045 | 962964..963248 | + | 285 | WP_000998180.1 | hypothetical protein | - |
| E0E10_RS05050 | 963245..963886 | + | 642 | WP_001019783.1 | hypothetical protein | - |
| E0E10_RS05055 | 964335..964676 | + | 342 | WP_001190616.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | selk / selq | 936928..966990 | 30062 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11590.08 Da Isoelectric Point: 4.9594
>T286086 WP_001103946.1 NZ_LR027878:959574-959867 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASLQADQSESNA
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASLQADQSESNA
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0C6E6D5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | X5IA75 |