Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 886433..886910 Replicon chromosome
Accession NZ_LR027877
Organism Staphylococcus aureus isolate BPH3244

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag E0E14_RS04485 Protein ID WP_000052078.1
Coordinates 886433..886621 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag E0E14_RS04490 Protein ID WP_001059690.1
Coordinates 886650..886910 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E0E14_RS04455 882474..882944 + 471 WP_000824472.1 hypothetical protein -
E0E14_RS04460 883285..883971 + 687 WP_001548082.1 thermonuclease family protein -
E0E14_RS04465 884328..884528 + 201 WP_001059082.1 cold-shock protein -
E0E14_RS04470 885024..885242 - 219 WP_000005877.1 hypothetical protein -
E0E14_RS04475 885304..885588 - 285 WP_001004395.1 hypothetical protein -
E0E14_RS04480 885676..886245 - 570 WP_001106654.1 hypothetical protein -
E0E14_RS04485 886433..886621 - 189 WP_000052078.1 hypothetical protein Toxin
E0E14_RS04490 886650..886910 - 261 WP_001059690.1 hypothetical protein Antitoxin
E0E14_RS04495 887251..887454 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
E0E14_RS04500 887451..887687 - 237 WP_000368687.1 hypothetical protein -
E0E14_RS04505 887912..888493 + 582 WP_001140686.1 phosphoglycerate mutase family protein -
E0E14_RS04510 888566..889183 - 618 WP_000255564.1 LysE/ArgO family amino acid transporter -
E0E14_RS04515 889338..889832 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
E0E14_RS04520 890231..890653 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
E0E14_RS04525 890801..891517 + 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage ant(9)-Ia / erm(A) vWbp / selk / selq 856645..917906 61261


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T286069 WP_000052078.1 NZ_LR027877:c886621-886433 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT286069 WP_001059690.1 NZ_LR027877:c886910-886650 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References