Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 859288..859820 Replicon chromosome
Accession NZ_LR027877
Organism Staphylococcus aureus isolate BPH3244

Toxin (Protein)


Gene name TscT Uniprot ID Q93CD4
Locus tag E0E14_RS04325 Protein ID WP_001103942.1
Coordinates 859500..859820 (+) Length 107 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID -
Locus tag E0E14_RS04320 Protein ID WP_116100508.1
Coordinates 859288..859497 (+) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E0E14_RS04285 855618..856082 + 465 WP_001085185.1 SsrA-binding protein SmpB -
E0E14_RS04295 856645..857751 - 1107 WP_106699245.1 site-specific integrase -
E0E14_RS04300 857741..858544 - 804 WP_000358990.1 helix-turn-helix domain-containing protein -
E0E14_RS04305 858680..858883 + 204 WP_001045296.1 transcriptional regulator -
E0E14_RS04310 858919..859137 + 219 WP_000163544.1 helix-turn-helix domain-containing protein -
E0E14_RS04315 859149..859295 + 147 WP_000784885.1 hypothetical protein -
E0E14_RS04320 859288..859497 + 210 WP_116100508.1 pathogenicity island protein Antitoxin
E0E14_RS04325 859500..859820 + 321 WP_001103942.1 DUF1474 family protein Toxin
E0E14_RS04330 859884..860753 + 870 WP_130826599.1 primase alpha helix C-terminal domain-containing protein -
E0E14_RS04335 860770..862239 + 1470 WP_053040304.1 virulence-associated E family protein -
E0E14_RS04340 862518..862880 + 363 WP_001039165.1 hypothetical protein -
E0E14_RS04345 862882..863145 + 264 WP_001804819.1 hypothetical protein -
E0E14_RS04350 863147..863788 + 642 WP_116100509.1 pathogenicity island protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage ant(9)-Ia / erm(A) vWbp / selk / selq 856645..917906 61261


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-98)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 12694.22 Da        Isoelectric Point: 4.7419

>T286068 WP_001103942.1 NZ_LR027877:859500-859820 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFSELIQKF
HEIEKASSENFDEESDDAKNSIKVAE

Download         Length: 321 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8166.22 Da        Isoelectric Point: 4.4665

>AT286068 WP_116100508.1 NZ_LR027877:859288-859497 [Staphylococcus aureus]
MNNEQKEVIEHVVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLGKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q93CD4

Antitoxin

Source ID Structure

References