Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2223593..2224122 | Replicon | chromosome |
Accession | NZ_LR027876 | ||
Organism | Staphylococcus aureus strain JKD6009 isolate JKD6009 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | E0E12_RS11770 | Protein ID | WP_000621175.1 |
Coordinates | 2223593..2223955 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | E0E12_RS11775 | Protein ID | WP_000948331.1 |
Coordinates | 2223952..2224122 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0E12_RS11745 | 2220572..2221342 | - | 771 | WP_001041103.1 | RNA polymerase sigma factor SigB | - |
E0E12_RS11750 | 2221317..2221796 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
E0E12_RS11755 | 2221798..2222124 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
E0E12_RS11760 | 2222243..2223244 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
E0E12_RS11770 | 2223593..2223955 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
E0E12_RS11775 | 2223952..2224122 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
E0E12_RS11780 | 2224207..2225355 | - | 1149 | WP_001281145.1 | alanine racemase | - |
E0E12_RS11785 | 2225421..2225780 | - | 360 | WP_000581200.1 | holo-ACP synthase | - |
E0E12_RS11790 | 2225784..2226275 | - | 492 | WP_001205910.1 | PH domain-containing protein | - |
E0E12_RS11795 | 2226262..2227845 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
E0E12_RS11800 | 2227838..2228317 | - | 480 | WP_001287088.1 | hypothetical protein | - |
E0E12_RS11805 | 2228525..2229085 | - | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T286059 WP_000621175.1 NZ_LR027876:c2223955-2223593 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|