Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 885655..886132 Replicon chromosome
Accession NZ_LR027876
Organism Staphylococcus aureus strain JKD6009 isolate JKD6009

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag E0E12_RS04490 Protein ID WP_000052078.1
Coordinates 885655..885843 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag E0E12_RS04495 Protein ID WP_001059690.1
Coordinates 885872..886132 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E0E12_RS04460 881696..882166 + 471 WP_000824472.1 hypothetical protein -
E0E12_RS04465 882507..883193 + 687 WP_001548082.1 thermonuclease family protein -
E0E12_RS04470 883550..883750 + 201 WP_001059082.1 cold-shock protein -
E0E12_RS04475 884246..884464 - 219 WP_000005877.1 hypothetical protein -
E0E12_RS04480 884526..884810 - 285 WP_001004395.1 hypothetical protein -
E0E12_RS04485 884898..885467 - 570 WP_001106654.1 hypothetical protein -
E0E12_RS04490 885655..885843 - 189 WP_000052078.1 hypothetical protein Toxin
E0E12_RS04495 885872..886132 - 261 WP_001059690.1 hypothetical protein Antitoxin
E0E12_RS04500 886473..886676 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
E0E12_RS04505 886673..886909 - 237 WP_000368687.1 hypothetical protein -
E0E12_RS04510 887134..887715 + 582 WP_001140686.1 phosphoglycerate mutase family protein -
E0E12_RS04515 887788..888405 - 618 WP_000255564.1 LysE/ArgO family amino acid transporter -
E0E12_RS04520 888560..889054 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
E0E12_RS04525 889453..889875 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
E0E12_RS04530 890023..890739 + 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage ant(9)-Ia / erm(A) selk / selq 880339..917086 36747


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T286052 WP_000052078.1 NZ_LR027876:c885843-885655 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT286052 WP_001059690.1 NZ_LR027876:c886132-885872 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References