Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2296594..2297123 | Replicon | chromosome |
| Accession | NZ_LR027874 | ||
| Organism | Staphylococcus aureus strain BPH2056 isolate BPH2056 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | E0E13_RS12065 | Protein ID | WP_000621175.1 |
| Coordinates | 2296594..2296956 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | E0E13_RS12070 | Protein ID | WP_000948331.1 |
| Coordinates | 2296953..2297123 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E13_RS12040 | 2293573..2294343 | - | 771 | WP_001041103.1 | RNA polymerase sigma factor SigB | - |
| E0E13_RS12045 | 2294318..2294797 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| E0E13_RS12050 | 2294799..2295125 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| E0E13_RS12055 | 2295244..2296245 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| E0E13_RS12065 | 2296594..2296956 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| E0E13_RS12070 | 2296953..2297123 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| E0E13_RS12075 | 2297208..2298356 | - | 1149 | WP_001281145.1 | alanine racemase | - |
| E0E13_RS12080 | 2298422..2298781 | - | 360 | WP_000581200.1 | holo-ACP synthase | - |
| E0E13_RS12085 | 2298785..2299276 | - | 492 | WP_001205910.1 | PH domain-containing protein | - |
| E0E13_RS12090 | 2299263..2300846 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
| E0E13_RS12095 | 2300839..2301318 | - | 480 | WP_001287088.1 | hypothetical protein | - |
| E0E13_RS12100 | 2301526..2302086 | - | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T286043 WP_000621175.1 NZ_LR027874:c2296956-2296594 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|