Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-doc |
| Location | 2176860..2177485 | Replicon | chromosome |
| Accession | NZ_LR027874 | ||
| Organism | Staphylococcus aureus strain BPH2056 isolate BPH2056 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A380FZ43 |
| Locus tag | E0E13_RS11445 | Protein ID | WP_001179607.1 |
| Coordinates | 2176860..2177255 (-) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | A0A380FXS4 |
| Locus tag | E0E13_RS11450 | Protein ID | WP_000258939.1 |
| Coordinates | 2177255..2177485 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E13_RS11410 | 2172539..2173081 | - | 543 | WP_000627290.1 | streptothricin N-acetyltransferase Sat4 | - |
| E0E13_RS11415 | 2173078..2173713 | - | 636 | Protein_2112 | aminoglycoside 6-adenylyltransferase | - |
| E0E13_RS11420 | 2173928..2174650 | - | 723 | WP_001043218.1 | hypothetical protein | - |
| E0E13_RS11425 | 2174759..2175559 | - | 801 | WP_000686449.1 | metallophosphoesterase | - |
| E0E13_RS11430 | 2175563..2176057 | - | 495 | WP_000280790.1 | hypothetical protein | - |
| E0E13_RS11435 | 2176114..2176383 | - | 270 | WP_000755772.1 | hypothetical protein | - |
| E0E13_RS11440 | 2176367..2176558 | - | 192 | WP_032605691.1 | hypothetical protein | - |
| E0E13_RS11445 | 2176860..2177255 | - | 396 | WP_001179607.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| E0E13_RS11450 | 2177255..2177485 | - | 231 | WP_000258939.1 | addiction module antitoxin | Antitoxin |
| E0E13_RS11455 | 2177661..2178182 | - | 522 | WP_000639078.1 | metallophosphoesterase | - |
| E0E13_RS11460 | 2178182..2178832 | - | 651 | WP_000411528.1 | hypothetical protein | - |
| E0E13_RS11465 | 2178832..2179149 | - | 318 | WP_001807410.1 | hypothetical protein | - |
| E0E13_RS11470 | 2179142..2179867 | - | 726 | WP_000197304.1 | metallophosphoesterase | - |
| E0E13_RS11475 | 2179867..2180088 | - | 222 | WP_000829423.1 | hypothetical protein | - |
| E0E13_RS15990 | 2180108..2180284 | - | 177 | WP_000063384.1 | hypothetical protein | - |
| E0E13_RS11480 | 2180277..2180819 | - | 543 | WP_000858632.1 | hypothetical protein | - |
| E0E13_RS11485 | 2180834..2181106 | - | 273 | WP_000691100.1 | hypothetical protein | - |
| E0E13_RS11490 | 2181132..2181287 | - | 156 | WP_000792995.1 | transcriptional regulator | - |
| E0E13_RS15995 | 2181401..2181568 | - | 168 | WP_000312832.1 | hypothetical protein | - |
| E0E13_RS11495 | 2181584..2181769 | - | 186 | WP_001187008.1 | hypothetical protein | - |
| E0E13_RS11500 | 2181754..2181933 | - | 180 | WP_000401832.1 | hypothetical protein | - |
| E0E13_RS11505 | 2181947..2182429 | - | 483 | WP_000833764.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2173928..2268307 | 94379 | |
| - | inside | Prophage | aac(6')-aph(2'') / aph(3')-III | - | 2138061..2265187 | 127126 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 15035.51 Da Isoelectric Point: 9.4574
>T286042 WP_001179607.1 NZ_LR027874:c2177255-2176860 [Staphylococcus aureus]
MQNIKYLTEKQVIAINVKAIQELSPKEQVGVKVPEVLNATIEGVKQSFGGVELYETIERKAAFIYRNIAQKHAFFNANKR
TAFTSMVIFLKLNKINFNCTQDEAVQFTLKVVEDKTLTLEDIADWIKRHCK
MQNIKYLTEKQVIAINVKAIQELSPKEQVGVKVPEVLNATIEGVKQSFGGVELYETIERKAAFIYRNIAQKHAFFNANKR
TAFTSMVIFLKLNKINFNCTQDEAVQFTLKVVEDKTLTLEDIADWIKRHCK
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A380FZ43 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A380FXS4 |