Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-doc
Location 2176860..2177485 Replicon chromosome
Accession NZ_LR027874
Organism Staphylococcus aureus strain BPH2056 isolate BPH2056

Toxin (Protein)


Gene name doc Uniprot ID A0A380FZ43
Locus tag E0E13_RS11445 Protein ID WP_001179607.1
Coordinates 2176860..2177255 (-) Length 132 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A380FXS4
Locus tag E0E13_RS11450 Protein ID WP_000258939.1
Coordinates 2177255..2177485 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E0E13_RS11410 2172539..2173081 - 543 WP_000627290.1 streptothricin N-acetyltransferase Sat4 -
E0E13_RS11415 2173078..2173713 - 636 Protein_2112 aminoglycoside 6-adenylyltransferase -
E0E13_RS11420 2173928..2174650 - 723 WP_001043218.1 hypothetical protein -
E0E13_RS11425 2174759..2175559 - 801 WP_000686449.1 metallophosphoesterase -
E0E13_RS11430 2175563..2176057 - 495 WP_000280790.1 hypothetical protein -
E0E13_RS11435 2176114..2176383 - 270 WP_000755772.1 hypothetical protein -
E0E13_RS11440 2176367..2176558 - 192 WP_032605691.1 hypothetical protein -
E0E13_RS11445 2176860..2177255 - 396 WP_001179607.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
E0E13_RS11450 2177255..2177485 - 231 WP_000258939.1 addiction module antitoxin Antitoxin
E0E13_RS11455 2177661..2178182 - 522 WP_000639078.1 metallophosphoesterase -
E0E13_RS11460 2178182..2178832 - 651 WP_000411528.1 hypothetical protein -
E0E13_RS11465 2178832..2179149 - 318 WP_001807410.1 hypothetical protein -
E0E13_RS11470 2179142..2179867 - 726 WP_000197304.1 metallophosphoesterase -
E0E13_RS11475 2179867..2180088 - 222 WP_000829423.1 hypothetical protein -
E0E13_RS15990 2180108..2180284 - 177 WP_000063384.1 hypothetical protein -
E0E13_RS11480 2180277..2180819 - 543 WP_000858632.1 hypothetical protein -
E0E13_RS11485 2180834..2181106 - 273 WP_000691100.1 hypothetical protein -
E0E13_RS11490 2181132..2181287 - 156 WP_000792995.1 transcriptional regulator -
E0E13_RS15995 2181401..2181568 - 168 WP_000312832.1 hypothetical protein -
E0E13_RS11495 2181584..2181769 - 186 WP_001187008.1 hypothetical protein -
E0E13_RS11500 2181754..2181933 - 180 WP_000401832.1 hypothetical protein -
E0E13_RS11505 2181947..2182429 - 483 WP_000833764.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2173928..2268307 94379
- inside Prophage aac(6')-aph(2'') / aph(3')-III - 2138061..2265187 127126


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-129)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 15035.51 Da        Isoelectric Point: 9.4574

>T286042 WP_001179607.1 NZ_LR027874:c2177255-2176860 [Staphylococcus aureus]
MQNIKYLTEKQVIAINVKAIQELSPKEQVGVKVPEVLNATIEGVKQSFGGVELYETIERKAAFIYRNIAQKHAFFNANKR
TAFTSMVIFLKLNKINFNCTQDEAVQFTLKVVEDKTLTLEDIADWIKRHCK

Download         Length: 396 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8617.73 Da        Isoelectric Point: 4.4501

>AT286042 WP_000258939.1 NZ_LR027874:c2177485-2177255 [Staphylococcus aureus]
MVTTRKLRRAGNSSVVSVPTEVIAALGVTNGDNLKFNIEDNKVTIEKEVNEDEEFFKLLDETFTEYNQALRKLVDI

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A380FZ43

Antitoxin

Source ID Structure
AlphaFold DB A0A380FXS4

References