Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | TscAT/- |
| Location | 911658..912163 | Replicon | chromosome |
| Accession | NZ_LR027870 | ||
| Organism | Staphylococcus aureus strain BPH2019 isolate BPH2019 | ||
Toxin (Protein)
| Gene name | TscT | Uniprot ID | A0A0C6E6D5 |
| Locus tag | E0E15_RS04680 | Protein ID | WP_001103946.1 |
| Coordinates | 911870..912163 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | TscA | Uniprot ID | X5IA75 |
| Locus tag | E0E15_RS04675 | Protein ID | WP_001058492.1 |
| Coordinates | 911658..911867 (+) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E15_RS04640 | 907176..908396 | - | 1221 | WP_000264182.1 | site-specific integrase | - |
| E0E15_RS04645 | 908484..909212 | - | 729 | WP_000733773.1 | staphylococcal enterotoxin type K | - |
| E0E15_RS04650 | 909236..909964 | - | 729 | WP_001033317.1 | staphylococcal enterotoxin type Q | - |
| E0E15_RS04655 | 910139..910872 | - | 734 | Protein_861 | helix-turn-helix transcriptional regulator | - |
| E0E15_RS04660 | 911022..911234 | + | 213 | WP_001063624.1 | helix-turn-helix transcriptional regulator | - |
| E0E15_RS04665 | 911235..911507 | + | 273 | WP_001138298.1 | helix-turn-helix domain-containing protein | - |
| E0E15_RS04670 | 911519..911665 | + | 147 | WP_000784885.1 | hypothetical protein | - |
| E0E15_RS04675 | 911658..911867 | + | 210 | WP_001058492.1 | hypothetical protein | Antitoxin |
| E0E15_RS04680 | 911870..912163 | + | 294 | WP_001103946.1 | DUF1474 family protein | Toxin |
| E0E15_RS04685 | 912251..913120 | + | 870 | WP_001002692.1 | primase alpha helix C-terminal domain-containing protein | - |
| E0E15_RS04690 | 913137..914594 | + | 1458 | WP_000432707.1 | virulence-associated E family protein | - |
| E0E15_RS04695 | 914896..915258 | + | 363 | WP_001039172.1 | hypothetical protein | - |
| E0E15_RS04700 | 915260..915544 | + | 285 | WP_000998180.1 | hypothetical protein | - |
| E0E15_RS04705 | 915541..916182 | + | 642 | WP_001019783.1 | hypothetical protein | - |
| E0E15_RS04710 | 916631..916972 | + | 342 | WP_001190616.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | ant(9)-Ia / erm(A) | selk / selq | 882540..919286 | 36746 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11590.08 Da Isoelectric Point: 4.9594
>T286010 WP_001103946.1 NZ_LR027870:911870-912163 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASLQADQSESNA
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASLQADQSESNA
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0C6E6D5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | X5IA75 |