Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 911658..912163 Replicon chromosome
Accession NZ_LR027870
Organism Staphylococcus aureus strain BPH2019 isolate BPH2019

Toxin (Protein)


Gene name TscT Uniprot ID A0A0C6E6D5
Locus tag E0E15_RS04680 Protein ID WP_001103946.1
Coordinates 911870..912163 (+) Length 98 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID X5IA75
Locus tag E0E15_RS04675 Protein ID WP_001058492.1
Coordinates 911658..911867 (+) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E0E15_RS04640 907176..908396 - 1221 WP_000264182.1 site-specific integrase -
E0E15_RS04645 908484..909212 - 729 WP_000733773.1 staphylococcal enterotoxin type K -
E0E15_RS04650 909236..909964 - 729 WP_001033317.1 staphylococcal enterotoxin type Q -
E0E15_RS04655 910139..910872 - 734 Protein_861 helix-turn-helix transcriptional regulator -
E0E15_RS04660 911022..911234 + 213 WP_001063624.1 helix-turn-helix transcriptional regulator -
E0E15_RS04665 911235..911507 + 273 WP_001138298.1 helix-turn-helix domain-containing protein -
E0E15_RS04670 911519..911665 + 147 WP_000784885.1 hypothetical protein -
E0E15_RS04675 911658..911867 + 210 WP_001058492.1 hypothetical protein Antitoxin
E0E15_RS04680 911870..912163 + 294 WP_001103946.1 DUF1474 family protein Toxin
E0E15_RS04685 912251..913120 + 870 WP_001002692.1 primase alpha helix C-terminal domain-containing protein -
E0E15_RS04690 913137..914594 + 1458 WP_000432707.1 virulence-associated E family protein -
E0E15_RS04695 914896..915258 + 363 WP_001039172.1 hypothetical protein -
E0E15_RS04700 915260..915544 + 285 WP_000998180.1 hypothetical protein -
E0E15_RS04705 915541..916182 + 642 WP_001019783.1 hypothetical protein -
E0E15_RS04710 916631..916972 + 342 WP_001190616.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage ant(9)-Ia / erm(A) selk / selq 882540..919286 36746


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-97)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11590.08 Da        Isoelectric Point: 4.9594

>T286010 WP_001103946.1 NZ_LR027870:911870-912163 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASLQADQSESNA

Download         Length: 294 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8238.28 Da        Isoelectric Point: 4.3718

>AT286010 WP_001058492.1 NZ_LR027870:911658-911867 [Staphylococcus aureus]
MNNEQKEVIEHVVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0C6E6D5

Antitoxin

Source ID Structure
AlphaFold DB X5IA75

References