Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 887856..888333 Replicon chromosome
Accession NZ_LR027870
Organism Staphylococcus aureus strain BPH2019 isolate BPH2019

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag E0E15_RS04495 Protein ID WP_000052078.1
Coordinates 887856..888044 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag E0E15_RS04500 Protein ID WP_001059690.1
Coordinates 888073..888333 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E0E15_RS04465 883897..884367 + 471 WP_000824472.1 hypothetical protein -
E0E15_RS04470 884708..885394 + 687 WP_001548082.1 thermonuclease family protein -
E0E15_RS04475 885751..885951 + 201 WP_001059082.1 cold-shock protein -
E0E15_RS04480 886447..886665 - 219 WP_000005877.1 hypothetical protein -
E0E15_RS04485 886727..887011 - 285 WP_001004395.1 hypothetical protein -
E0E15_RS04490 887099..887668 - 570 WP_001106654.1 hypothetical protein -
E0E15_RS04495 887856..888044 - 189 WP_000052078.1 hypothetical protein Toxin
E0E15_RS04500 888073..888333 - 261 WP_001059690.1 hypothetical protein Antitoxin
E0E15_RS04505 888674..888877 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
E0E15_RS04510 888874..889110 - 237 WP_000368687.1 hypothetical protein -
E0E15_RS04515 889335..889916 + 582 WP_001140686.1 phosphoglycerate mutase family protein -
E0E15_RS04520 889989..890606 - 618 WP_000255564.1 LysE/ArgO family amino acid transporter -
E0E15_RS04525 890761..891255 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
E0E15_RS04530 891654..892076 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
E0E15_RS04535 892224..892940 + 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage ant(9)-Ia / erm(A) selk / selq 882540..919286 36746


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T286009 WP_000052078.1 NZ_LR027870:c888044-887856 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT286009 WP_001059690.1 NZ_LR027870:c888333-888073 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References