Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | TscAT/- |
| Location | 860692..861224 | Replicon | chromosome |
| Accession | NZ_LR027870 | ||
| Organism | Staphylococcus aureus strain BPH2019 isolate BPH2019 | ||
Toxin (Protein)
| Gene name | TscT | Uniprot ID | Q93CD4 |
| Locus tag | E0E15_RS04335 | Protein ID | WP_001103942.1 |
| Coordinates | 860904..861224 (+) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | TscA | Uniprot ID | - |
| Locus tag | E0E15_RS04330 | Protein ID | WP_116100508.1 |
| Coordinates | 860692..860901 (+) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E15_RS04295 | 857022..857486 | + | 465 | WP_001085185.1 | SsrA-binding protein SmpB | - |
| E0E15_RS04305 | 858049..859155 | - | 1107 | WP_106699245.1 | site-specific integrase | - |
| E0E15_RS04310 | 859145..859948 | - | 804 | WP_000358990.1 | helix-turn-helix domain-containing protein | - |
| E0E15_RS04315 | 860084..860287 | + | 204 | WP_001045296.1 | transcriptional regulator | - |
| E0E15_RS04320 | 860323..860541 | + | 219 | WP_000163544.1 | helix-turn-helix domain-containing protein | - |
| E0E15_RS04325 | 860553..860699 | + | 147 | WP_000784885.1 | hypothetical protein | - |
| E0E15_RS04330 | 860692..860901 | + | 210 | WP_116100508.1 | pathogenicity island protein | Antitoxin |
| E0E15_RS04335 | 860904..861224 | + | 321 | WP_001103942.1 | DUF1474 family protein | Toxin |
| E0E15_RS04340 | 861288..862157 | + | 870 | WP_053040303.1 | primase alpha helix C-terminal domain-containing protein | - |
| E0E15_RS04345 | 862174..863643 | + | 1470 | WP_053040304.1 | virulence-associated E family protein | - |
| E0E15_RS04350 | 863922..864284 | + | 363 | WP_001039165.1 | hypothetical protein | - |
| E0E15_RS04355 | 864286..864549 | + | 264 | WP_001804819.1 | hypothetical protein | - |
| E0E15_RS04360 | 864551..865192 | + | 642 | WP_116100509.1 | pathogenicity island protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12694.22 Da Isoelectric Point: 4.7419
>T286008 WP_001103942.1 NZ_LR027870:860904-861224 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFSELIQKF
HEIEKASSENFDEESDDAKNSIKVAE
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFSELIQKF
HEIEKASSENFDEESDDAKNSIKVAE
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|