Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2232187..2232716 | Replicon | chromosome |
Accession | NZ_LR027869 | ||
Organism | Staphylococcus aureus isolate BPH2869 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | E0E09_RS11810 | Protein ID | WP_000621175.1 |
Coordinates | 2232187..2232549 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | E0E09_RS11815 | Protein ID | WP_000948331.1 |
Coordinates | 2232546..2232716 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0E09_RS11785 | 2229166..2229936 | - | 771 | WP_001041103.1 | RNA polymerase sigma factor SigB | - |
E0E09_RS11790 | 2229911..2230390 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
E0E09_RS11795 | 2230392..2230718 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
E0E09_RS11800 | 2230837..2231838 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
E0E09_RS11810 | 2232187..2232549 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
E0E09_RS11815 | 2232546..2232716 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
E0E09_RS11820 | 2232801..2233949 | - | 1149 | WP_001281145.1 | alanine racemase | - |
E0E09_RS11825 | 2234015..2234374 | - | 360 | WP_000581200.1 | holo-ACP synthase | - |
E0E09_RS11830 | 2234378..2234869 | - | 492 | WP_001205910.1 | PH domain-containing protein | - |
E0E09_RS11835 | 2234856..2236439 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
E0E09_RS11840 | 2236432..2236911 | - | 480 | WP_001287088.1 | hypothetical protein | - |
E0E09_RS11845 | 2237119..2237679 | - | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T285999 WP_000621175.1 NZ_LR027869:c2232549-2232187 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|