Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | TscAT/- |
Location | 873370..873902 | Replicon | chromosome |
Accession | NZ_LR027869 | ||
Organism | Staphylococcus aureus isolate BPH2869 |
Toxin (Protein)
Gene name | TscT | Uniprot ID | Q93CD4 |
Locus tag | E0E09_RS04430 | Protein ID | WP_001103942.1 |
Coordinates | 873582..873902 (+) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | TscA | Uniprot ID | - |
Locus tag | E0E09_RS04425 | Protein ID | WP_116100508.1 |
Coordinates | 873370..873579 (+) | Length | 70 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0E09_RS04390 | 869700..870164 | + | 465 | WP_001085185.1 | SsrA-binding protein SmpB | - |
E0E09_RS04400 | 870727..871833 | - | 1107 | WP_106699245.1 | site-specific integrase | - |
E0E09_RS04405 | 871823..872626 | - | 804 | WP_000358990.1 | helix-turn-helix domain-containing protein | - |
E0E09_RS04410 | 872762..872965 | + | 204 | WP_001045296.1 | transcriptional regulator | - |
E0E09_RS04415 | 873001..873219 | + | 219 | WP_000163544.1 | helix-turn-helix domain-containing protein | - |
E0E09_RS04420 | 873231..873377 | + | 147 | WP_000784885.1 | hypothetical protein | - |
E0E09_RS04425 | 873370..873579 | + | 210 | WP_116100508.1 | pathogenicity island protein | Antitoxin |
E0E09_RS04430 | 873582..873902 | + | 321 | WP_001103942.1 | DUF1474 family protein | Toxin |
E0E09_RS04435 | 873966..874835 | + | 870 | WP_130826599.1 | primase alpha helix C-terminal domain-containing protein | - |
E0E09_RS04440 | 874852..876321 | + | 1470 | WP_053040304.1 | virulence-associated E family protein | - |
E0E09_RS04445 | 876600..876962 | + | 363 | WP_001039165.1 | hypothetical protein | - |
E0E09_RS04450 | 876964..877227 | + | 264 | WP_001804819.1 | hypothetical protein | - |
E0E09_RS04455 | 877229..877870 | + | 642 | WP_116100509.1 | pathogenicity island protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | ant(9)-Ia / erm(A) | vWbp | 867306..918789 | 51483 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12694.22 Da Isoelectric Point: 4.7419
>T285992 WP_001103942.1 NZ_LR027869:873582-873902 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFSELIQKF
HEIEKASSENFDEESDDAKNSIKVAE
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFSELIQKF
HEIEKASSENFDEESDDAKNSIKVAE
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|