Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 5515201..5515723 Replicon chromosome
Accession NZ_LR027557
Organism Pseudomonas synxantha strain 10586

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag KR485_RS24545 Protein ID WP_057022032.1
Coordinates 5515201..5515494 (-) Length 98 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0W0N4Z1
Locus tag KR485_RS24550 Protein ID WP_014717442.1
Coordinates 5515484..5515723 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KR485_RS24515 5510594..5511154 - 561 WP_003189463.1 glycine cleavage system protein R -
KR485_RS24520 5511417..5512295 + 879 WP_032877264.1 4-hydroxy-tetrahydrodipicolinate synthase -
KR485_RS24525 5512313..5513428 + 1116 WP_078820545.1 outer membrane protein assembly factor BamC -
KR485_RS24530 5513433..5514191 + 759 WP_005786028.1 MBL fold metallo-hydrolase -
KR485_RS24535 5514219..5514932 + 714 WP_005786030.1 phosphoribosylaminoimidazolesuccinocarboxamide synthase -
KR485_RS24545 5515201..5515494 - 294 WP_057022032.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
KR485_RS24550 5515484..5515723 - 240 WP_014717442.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
KR485_RS24555 5516367..5516618 + 252 WP_103733513.1 DUF3077 domain-containing protein -
KR485_RS24560 5516692..5517918 - 1227 WP_032877262.1 MFS transporter -
KR485_RS24565 5518157..5518444 - 288 WP_003189536.1 NadS family protein -
KR485_RS24570 5518447..5518761 - 315 WP_057022036.1 type II toxin-antitoxin system RelE/ParE family toxin -
KR485_RS24575 5518867..5519808 - 942 WP_216090883.1 LysR family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - mucA / mucD 5505006..5518761 13755


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-84)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-64)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11585.38 Da        Isoelectric Point: 10.0977

>T285990 WP_057022032.1 NZ_LR027557:c5515494-5515201 [Pseudomonas synxantha]
MTYSLDFDARALKEWQKLGDTLRQQLKKKLMEILNNPRIEANRLHGLPDCYKIKLRSSGYRLVYQVIDQEVTVFVVAIDK
RERDQAYRKASERLDQR

Download         Length: 294 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8997.40 Da        Isoelectric Point: 4.6017

>AT285990 WP_014717442.1 NZ_LR027557:c5515723-5515484 [Pseudomonas synxantha]
MASINIRIDDDLKARAYLELEKLGVTPSELIRQALQYVAERGQLPFKPVLMTEEDEALMATVRERLASPQRVRVSLDDL

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0W0N4Z1

References