Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 5482521..5483136 | Replicon | chromosome |
| Accession | NZ_LR027557 | ||
| Organism | Pseudomonas synxantha strain 10586 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | KR485_RS24360 | Protein ID | WP_078820528.1 |
| Coordinates | 5482954..5483136 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A5D3GIE6 |
| Locus tag | KR485_RS24355 | Protein ID | WP_032877288.1 |
| Coordinates | 5482521..5482931 (-) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KR485_RS24320 | 5478061..5478537 | - | 477 | WP_032877293.1 | DMT family transporter | - |
| KR485_RS24325 | 5478624..5479532 | + | 909 | WP_248130097.1 | LysR family transcriptional regulator | - |
| KR485_RS24330 | 5479548..5479964 | + | 417 | WP_216090872.1 | fosfomycin resistance glutathione transferase | - |
| KR485_RS24335 | 5480012..5480653 | + | 642 | WP_032877291.1 | LysE family translocator | - |
| KR485_RS24340 | 5480772..5481299 | + | 528 | WP_005785958.1 | DUF4142 domain-containing protein | - |
| KR485_RS24345 | 5481353..5481769 | - | 417 | WP_103733494.1 | low affinity iron permease family protein | - |
| KR485_RS24350 | 5481881..5482381 | - | 501 | WP_216090873.1 | methylated-DNA--[protein]-cysteine S-methyltransferase | - |
| KR485_RS24355 | 5482521..5482931 | - | 411 | WP_032877288.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| KR485_RS24360 | 5482954..5483136 | - | 183 | WP_078820528.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| KR485_RS24365 | 5483304..5484197 | - | 894 | WP_216090874.1 | LysR family transcriptional regulator | - |
| KR485_RS24370 | 5484293..5485462 | + | 1170 | WP_078820530.1 | MFS transporter | - |
| KR485_RS24380 | 5485742..5486626 | - | 885 | WP_078820531.1 | alpha/beta hydrolase | - |
| KR485_RS24385 | 5486931..5487623 | - | 693 | WP_216090875.1 | pseudouridine synthase | - |
| KR485_RS24390 | 5487613..5487825 | - | 213 | WP_216090876.1 | cysteine-rich CWC family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6840.04 Da Isoelectric Point: 10.9586
>T285989 WP_078820528.1 NZ_LR027557:c5483136-5482954 [Pseudomonas synxantha]
VDSRYLIGNIVADGWYLVRIRGSHHHFKHRTKPGLVTIPHPKKDLLDKTAKSILKQALLS
VDSRYLIGNIVADGWYLVRIRGSHHHFKHRTKPGLVTIPHPKKDLLDKTAKSILKQALLS
Download Length: 183 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14769.64 Da Isoelectric Point: 4.2941
>AT285989 WP_032877288.1 NZ_LR027557:c5482931-5482521 [Pseudomonas synxantha]
MLYPIAISTGDEDHAWGVEVPDIPGCYSAGDDLDDAMAMAREAIEGHFEILAEDGAPIPSAQKVTLHAANPQYAGCTWAV
VDIDVTKYLGKAQKLNITLPGYLLNRIDDYVLNHPEEKSRSGFLASAALKVLQQDR
MLYPIAISTGDEDHAWGVEVPDIPGCYSAGDDLDDAMAMAREAIEGHFEILAEDGAPIPSAQKVTLHAANPQYAGCTWAV
VDIDVTKYLGKAQKLNITLPGYLLNRIDDYVLNHPEEKSRSGFLASAALKVLQQDR
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|