Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 1919612..1920215 | Replicon | chromosome |
Accession | NZ_LR027557 | ||
Organism | Pseudomonas synxantha strain 10586 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | - |
Locus tag | KR485_RS08315 | Protein ID | WP_216091866.1 |
Coordinates | 1919612..1919953 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | - |
Locus tag | KR485_RS08320 | Protein ID | WP_216091867.1 |
Coordinates | 1919967..1920215 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KR485_RS28320 | 1914682..1914965 | - | 284 | Protein_1647 | tyrosine-type recombinase/integrase | - |
KR485_RS08295 | 1915277..1916941 | + | 1665 | WP_216091863.1 | colicin-like pore-forming protein | - |
KR485_RS08300 | 1917019..1917579 | + | 561 | WP_216091864.1 | hypothetical protein | - |
KR485_RS08305 | 1917790..1918749 | - | 960 | WP_216091865.1 | tyrosine-type recombinase/integrase | - |
KR485_RS08310 | 1918734..1919294 | - | 561 | WP_248130019.1 | N-acetyltransferase | - |
KR485_RS08315 | 1919612..1919953 | - | 342 | WP_216091866.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
KR485_RS08320 | 1919967..1920215 | - | 249 | WP_216091867.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
KR485_RS08325 | 1920417..1920749 | - | 333 | WP_216091868.1 | stability/partitioning determinant | - |
KR485_RS08330 | 1921089..1921421 | + | 333 | WP_216091869.1 | hypothetical protein | - |
KR485_RS08335 | 1921440..1921682 | + | 243 | WP_216091870.1 | hypothetical protein | - |
KR485_RS08340 | 1921784..1922131 | + | 348 | WP_197880951.1 | hypothetical protein | - |
KR485_RS08345 | 1922223..1922552 | + | 330 | WP_216091871.1 | hypothetical protein | - |
KR485_RS08350 | 1922569..1922775 | + | 207 | WP_216091872.1 | hypothetical protein | - |
KR485_RS08355 | 1922792..1923394 | + | 603 | WP_216091873.1 | hypothetical protein | - |
KR485_RS08360 | 1923667..1923822 | + | 156 | WP_197880954.1 | hypothetical protein | - |
KR485_RS08365 | 1923922..1924221 | + | 300 | Protein_1662 | DUF4158 domain-containing protein | - |
KR485_RS08370 | 1924636..1924887 | + | 252 | Protein_1663 | hypothetical protein | - |
KR485_RS08375 | 1924878..1925073 | + | 196 | Protein_1664 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1902293..1927435 | 25142 | |
- | flank | IS/Tn | - | - | 1924009..1924254 | 245 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12965.82 Da Isoelectric Point: 5.4880
>T285987 WP_216091866.1 NZ_LR027557:c1919953-1919612 [Pseudomonas synxantha]
MTTLTIRYTEIAQQSIEDQVEHLAEYHSLDYALHRLDTVIDVLQKKLLSTPLGYPISSQASELGILHYRELNTDGYRVFY
EIVEADQAIVVALVLRDKQSVEKALVRHCLLHT
MTTLTIRYTEIAQQSIEDQVEHLAEYHSLDYALHRLDTVIDVLQKKLLSTPLGYPISSQASELGILHYRELNTDGYRVFY
EIVEADQAIVVALVLRDKQSVEKALVRHCLLHT
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|