Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-PHD |
Location | 3825731..3826416 | Replicon | chromosome |
Accession | NZ_LR027516 | ||
Organism | Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TIR9 |
Locus tag | DKC2_RS18710 | Protein ID | WP_003417998.1 |
Coordinates | 3826006..3826416 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | DKC2_RS18705 | Protein ID | WP_003912220.1 |
Coordinates | 3825731..3826009 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DKC2_RS18685 | 3821720..3823321 | - | 1602 | WP_003417969.1 | FAD/NAD(P)-binding protein | - |
DKC2_RS18690 | 3823338..3824042 | - | 705 | WP_003417980.1 | dTDP-4-amino-4,6-dideoxyglucose formyltransferase | - |
DKC2_RS18695 | 3824160..3824726 | - | 567 | WP_003417984.1 | TetR/AcrR family transcriptional regulator | - |
DKC2_RS18700 | 3824788..3825675 | + | 888 | WP_003900050.1 | alpha-ketoglutarate-dependent sulfate ester dioxygenase | - |
DKC2_RS18705 | 3825731..3826009 | + | 279 | WP_003912220.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
DKC2_RS18710 | 3826006..3826416 | + | 411 | WP_003417998.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
DKC2_RS18715 | 3826449..3828185 | - | 1737 | WP_003418002.1 | cholesterol oxidase | - |
DKC2_RS18720 | 3828241..3829368 | - | 1128 | WP_003418005.1 | GuaB3 family IMP dehydrogenase-related protein | - |
DKC2_RS18725 | 3829388..3830977 | - | 1590 | WP_003900682.1 | IMP dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14695.84 Da Isoelectric Point: 5.1784
>T285981 WP_003417998.1 NZ_LR027516:3826006-3826416 [Mycobacterium tuberculosis]
VIYMDTSALTKLLISEPETTELRTWLTAQSGQGEDAATSTLGRVELMRVVARYGQPGQTERARYLLDGLDILPLTEPVIG
LAETIGPATLRSLDAIHLAAAAQIKRELTAFVTYDHRLLSGCREVGFVTASPGAVR
VIYMDTSALTKLLISEPETTELRTWLTAQSGQGEDAATSTLGRVELMRVVARYGQPGQTERARYLLDGLDILPLTEPVIG
LAETIGPATLRSLDAIHLAAAAQIKRELTAFVTYDHRLLSGCREVGFVTASPGAVR
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|