Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 3708181..3708855 Replicon chromosome
Accession NZ_LR027516
Organism Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID P9WF52
Locus tag DKC2_RS18190 Protein ID WP_003417282.1
Coordinates 3708181..3708609 (-) Length 143 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TI59
Locus tag DKC2_RS18195 Protein ID WP_003417286.1
Coordinates 3708613..3708855 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DKC2_RS18165 3704003..3704404 - 402 WP_003417264.1 cytidine deaminase -
DKC2_RS18170 3704545..3704979 + 435 WP_003900017.1 succinate dehydrogenase, cytochrome b556 subunit -
DKC2_RS18175 3704976..3705410 + 435 WP_003417269.1 succinate dehydrogenase hydrophobic membrane anchor subunit -
DKC2_RS18180 3705539..3707311 + 1773 WP_003417273.1 succinate dehydrogenase flavoprotein subunit -
DKC2_RS18185 3707311..3708102 + 792 WP_003417279.1 succinate dehydrogenase iron-sulfur subunit -
DKC2_RS18190 3708181..3708609 - 429 WP_003417282.1 type II toxin-antitoxin system VapC family toxin Toxin
DKC2_RS18195 3708613..3708855 - 243 WP_003417286.1 ribbon-helix-helix domain-containing protein Antitoxin
DKC2_RS18200 3708977..3709591 - 615 WP_003417288.1 class I SAM-dependent methyltransferase -
DKC2_RS18205 3709588..3710253 - 666 WP_003417290.1 molybdopterin converting factor subunit 1 -
DKC2_RS18210 3710254..3710787 - 534 WP_003417293.1 cyclic pyranopterin monophosphate synthase MoaC -
DKC2_RS18215 3710784..3711059 - 276 WP_078377809.1 4a-hydroxytetrahydrobiopterin dehydratase -
DKC2_RS21695 3712421..3712516 - 96 Protein_3439 4a-hydroxytetrahydrobiopterin dehydratase -
DKC2_RS18230 3712613..3713677 - 1065 WP_078446969.1 GTP 3',8-cyclase MoaA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-141)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 143 a.a.        Molecular weight: 15834.16 Da        Isoelectric Point: 8.5471

>T285978 WP_003417282.1 NZ_LR027516:c3708609-3708181 [Mycobacterium tuberculosis]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL

Download         Length: 429 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8849.86 Da        Isoelectric Point: 5.1007

>AT285978 WP_003417286.1 NZ_LR027516:c3708855-3708613 [Mycobacterium tuberculosis]
MRTTLSIDDDVLLAVKERARREKRTAGEILSDLARQALTNQNPQPAASQEDAFHGFEPLPHRGGAVSNALIDRLRDEEAV

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4FBL0

Antitoxin

Source ID Structure
AlphaFold DB G0TI59

References