Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3708181..3708855 | Replicon | chromosome |
Accession | NZ_LR027516 | ||
Organism | Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WF52 |
Locus tag | DKC2_RS18190 | Protein ID | WP_003417282.1 |
Coordinates | 3708181..3708609 (-) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TI59 |
Locus tag | DKC2_RS18195 | Protein ID | WP_003417286.1 |
Coordinates | 3708613..3708855 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DKC2_RS18165 | 3704003..3704404 | - | 402 | WP_003417264.1 | cytidine deaminase | - |
DKC2_RS18170 | 3704545..3704979 | + | 435 | WP_003900017.1 | succinate dehydrogenase, cytochrome b556 subunit | - |
DKC2_RS18175 | 3704976..3705410 | + | 435 | WP_003417269.1 | succinate dehydrogenase hydrophobic membrane anchor subunit | - |
DKC2_RS18180 | 3705539..3707311 | + | 1773 | WP_003417273.1 | succinate dehydrogenase flavoprotein subunit | - |
DKC2_RS18185 | 3707311..3708102 | + | 792 | WP_003417279.1 | succinate dehydrogenase iron-sulfur subunit | - |
DKC2_RS18190 | 3708181..3708609 | - | 429 | WP_003417282.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
DKC2_RS18195 | 3708613..3708855 | - | 243 | WP_003417286.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
DKC2_RS18200 | 3708977..3709591 | - | 615 | WP_003417288.1 | class I SAM-dependent methyltransferase | - |
DKC2_RS18205 | 3709588..3710253 | - | 666 | WP_003417290.1 | molybdopterin converting factor subunit 1 | - |
DKC2_RS18210 | 3710254..3710787 | - | 534 | WP_003417293.1 | cyclic pyranopterin monophosphate synthase MoaC | - |
DKC2_RS18215 | 3710784..3711059 | - | 276 | WP_078377809.1 | 4a-hydroxytetrahydrobiopterin dehydratase | - |
DKC2_RS21695 | 3712421..3712516 | - | 96 | Protein_3439 | 4a-hydroxytetrahydrobiopterin dehydratase | - |
DKC2_RS18230 | 3712613..3713677 | - | 1065 | WP_078446969.1 | GTP 3',8-cyclase MoaA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15834.16 Da Isoelectric Point: 8.5471
>T285978 WP_003417282.1 NZ_LR027516:c3708609-3708181 [Mycobacterium tuberculosis]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FBL0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TI59 |