Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 3185848..3186396 | Replicon | chromosome |
Accession | NZ_LR027516 | ||
Organism | Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | relE | Uniprot ID | G0TFG5 |
Locus tag | DKC2_RS15700 | Protein ID | WP_003414602.1 |
Coordinates | 3186133..3186396 (+) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | O33347 |
Locus tag | DKC2_RS15695 | Protein ID | WP_003414599.1 |
Coordinates | 3185848..3186129 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DKC2_RS15670 | 3181471..3182328 | - | 858 | WP_003899513.1 | type I methionyl aminopeptidase | - |
DKC2_RS15675 | 3182370..3182954 | - | 585 | WP_003899514.1 | DUF1707 domain-containing protein | - |
DKC2_RS15680 | 3183058..3183306 | + | 249 | WP_003913411.1 | antitoxin VapB23 | - |
DKC2_RS15685 | 3183303..3183683 | + | 381 | WP_003414592.1 | type II toxin-antitoxin system VapC family toxin | - |
DKC2_RS15690 | 3183765..3185576 | - | 1812 | WP_003414596.1 | penicillin-binding protein | - |
DKC2_RS15695 | 3185848..3186129 | + | 282 | WP_003414599.1 | type II toxin-antitoxin system antitoxin RelF | Antitoxin |
DKC2_RS15700 | 3186133..3186396 | + | 264 | WP_003414602.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DKC2_RS15705 | 3186769..3187623 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
DKC2_RS15710 | 3187679..3188842 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
DKC2_RS15715 | 3188859..3190073 | - | 1215 | WP_003899518.1 | zinc metalloprotease Rip | - |
DKC2_RS15720 | 3190081..3191322 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10204.82 Da Isoelectric Point: 11.5078
>T285975 WP_003414602.1 NZ_LR027516:3186133-3186396 [Mycobacterium tuberculosis]
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 3G5O |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 3G5O | |
AlphaFold DB | A0A7U4BWP8 |