Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN_Sll0205-like-Phd
Location 3144931..3145535 Replicon chromosome
Accession NZ_LR027516
Organism Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID P71623
Locus tag DKC2_RS15495 Protein ID WP_003414492.1
Coordinates 3144931..3145323 (-) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A829CBY8
Locus tag DKC2_RS15500 Protein ID WP_003414495.1
Coordinates 3145320..3145535 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DKC2_RS15465 3140081..3140869 - 789 WP_003917092.1 CRISPR-associated endoribonuclease Cas6 -
DKC2_RS15470 3141203..3141748 - 546 WP_003913758.1 DUF1802 family protein -
DKC2_RS15475 3142020..3142904 - 885 WP_003414409.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
DKC2_RS15480 3142907..3143794 - 888 WP_003414414.1 type IV toxin-antitoxin system AbiEi family antitoxin -
DKC2_RS15485 3144099..3144644 - 546 WP_003899500.1 DUF1802 family protein -
DKC2_RS15490 3144641..3144910 - 270 WP_003414489.1 DUF2277 family protein -
DKC2_RS15495 3144931..3145323 - 393 WP_003414492.1 type II toxin-antitoxin system VapC family toxin Toxin
DKC2_RS15500 3145320..3145535 - 216 WP_003414495.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
DKC2_RS15505 3145582..3146331 + 750 WP_003414497.1 enoyl-CoA hydratase -
DKC2_RS15510 3146410..3147492 - 1083 WP_003414499.1 ABC transporter ATP-binding protein -
DKC2_RS15515 3147485..3148795 - 1311 WP_003414501.1 ABC transporter substrate-binding protein -
DKC2_RS15520 3148798..3149625 - 828 WP_003414504.1 carbohydrate ABC transporter permease -
DKC2_RS15525 3149622..3150533 - 912 WP_003414505.1 sugar ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(5-130)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(2-46)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14610.74 Da        Isoelectric Point: 6.7594

>T285974 WP_003414492.1 NZ_LR027516:c3145323-3144931 [Mycobacterium tuberculosis]
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW

Download         Length: 393 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7511.55 Da        Isoelectric Point: 4.9732

>AT285974 WP_003414495.1 NZ_LR027516:c3145535-3145320 [Mycobacterium tuberculosis]
MTATEVKAKILSLLDEVAQGEEIEITKHGRTVARLVAATGPHALKGRFSGVAMAAVDDDELFTTGVSWNVS

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BWM8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CBY8

References