Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3116966..3117536 | Replicon | chromosome |
Accession | NZ_LR027516 | ||
Organism | Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | mazF | Uniprot ID | P71650 |
Locus tag | DKC2_RS15345 | Protein ID | WP_003414166.1 |
Coordinates | 3116966..3117322 (-) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P0CL61 |
Locus tag | DKC2_RS15350 | Protein ID | WP_003901465.1 |
Coordinates | 3117306..3117536 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DKC2_RS15325 | 3112418..3114106 | - | 1689 | WP_003414155.1 | alpha/beta hydrolase family protein | - |
DKC2_RS15330 | 3114110..3114436 | - | 327 | WP_003414157.1 | hypothetical protein | - |
DKC2_RS15335 | 3114609..3115196 | + | 588 | WP_003914429.1 | DUF3558 family protein | - |
DKC2_RS15340 | 3115215..3116864 | + | 1650 | WP_003899485.1 | CocE/NonD family hydrolase | - |
DKC2_RS15345 | 3116966..3117322 | - | 357 | WP_003414166.1 | type II toxin-antitoxin system toxin endoribonuclease MazF9 | Toxin |
DKC2_RS15350 | 3117306..3117536 | - | 231 | WP_003901465.1 | antitoxin MazE | Antitoxin |
DKC2_RS15355 | 3117579..3118622 | - | 1044 | WP_003414172.1 | DUF2293 domain-containing protein | - |
DKC2_RS15360 | 3118813..3119088 | + | 276 | WP_003911993.1 | DUF1778 domain-containing protein | - |
DKC2_RS21675 | 3119264..3119518 | - | 255 | WP_003917684.1 | hypothetical protein | - |
DKC2_RS15370 | 3119666..3120070 | + | 405 | WP_009938577.1 | hypothetical protein | - |
DKC2_RS15375 | 3120067..3120258 | + | 192 | WP_003414184.1 | hypothetical protein | - |
DKC2_RS15380 | 3120322..3121602 | + | 1281 | Protein_2904 | transposase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3116966..3129985 | 13019 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12858.73 Da Isoelectric Point: 9.1962
>T285972 WP_003414166.1 NZ_LR027516:c3117322-3116966 [Mycobacterium tuberculosis]
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|